DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and si:dkey-228b2.6

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001373166.1 Gene:si:dkey-228b2.6 / 563918 ZFINID:ZDB-GENE-141216-225 Length:183 Species:Danio rerio


Alignment Length:154 Identity:33/154 - (21%)
Similarity:67/154 - (43%) Gaps:24/154 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRD-NINPT-TACICNEHFAPNDFERNMQYELG 70
            |||.:.::      ::.||.::...:.|.....|| ...|: |:.:|:.||.|:.||.      |
Zfish     7 CGNIDGVS------FYKFPLQEERRRIWSVNMGRDVGWTPSETSSLCSAHFTPDCFES------G 59

  Fly    71 FSRKNPTKLKPGSFPSVNGPQKLAKELR-GSIKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSEGH 134
            .:|.:| ...|..|.......::.|:.. .|..:|:.:.| ..|::.:....:.....|:.|   
Zfish    60 SARLHP-DASPTLFNFTQPKNQIVKDTEIVSSHQGASTEP-KDSSRSTCCDCNKRLHATERS--- 119

  Fly   135 ETIEIQLCGFNTDIEGFEE--AED 156
              .:::|...|..|:.:::  ||:
Zfish   120 --YQLKLASANLQIKEYKKNLAEE 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 21/81 (26%)
GrpE 198..>239 CDD:295646
si:dkey-228b2.6NP_001373166.1 THAP 6..72 CDD:214951 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR46600
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.