DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and THAP12

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_004696.2 Gene:THAP12 / 5612 HGNCID:9440 Length:761 Species:Homo sapiens


Alignment Length:267 Identity:57/267 - (21%)
Similarity:96/267 - (35%) Gaps:81/267 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTACICNEHF--APNDFERNM 65
            ||..||   .|.:.::...:|.||::....|:|::.|:|.::...|....|:|:  ....||.:|
Human     5 CAAPNC---TRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSM 66

  Fly    66 QYELGFSRKNP--TKLKPGSFPSV-------NGP----QKLAKELRGSIKRGSKSVPLAGSTKMS 117
                 ..|.:|  |.|:..:.|::       |.|    :|..|||.....|..|...:..:::. 
Human    67 -----ICRTSPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQ- 125

  Fly   118 NIGFDPHHAGTQSSEGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNAKD 182
                :..|..|.:|......|             ||.|..|          |.:.||.       
Human   126 ----EQKHKETNNSNAQNPSE-------------EEGEGQD----------EDILPLT------- 156

  Fly   183 HVEIIDSEGDSYVKHL-ELEICSLKREV-------------FFLKDEYQKIKAEMRNLKDTIKRS 233
               :.:.|...|:|.| |:.|...|:.:             .|..|.:|.:      |:..|...
Human   157 ---LEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQAL------LECRINSG 212

  Fly   234 EEELAEK 240
            ||.|.::
Human   213 EEVLRKR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 23/95 (24%)
GrpE 198..>239 CDD:295646 12/54 (22%)
THAP12NP_004696.2 THAP 6..86 CDD:398893 22/87 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..149 7/50 (14%)
DUF4371 <157..330 CDD:405048 15/69 (22%)
Dimer_Tnp_hAT <672..729 CDD:399013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.