DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and thap3

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001014316.1 Gene:thap3 / 541481 ZFINID:ZDB-GENE-050327-4 Length:213 Species:Danio rerio


Alignment Length:237 Identity:65/237 - (27%)
Similarity:96/237 - (40%) Gaps:60/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFH-FPKEKPN-LQRWIDFCQRDNINPTT-ACICNEHFAPNDFERN 64
            |:..||  .||..|:.....|| ||..||: |::|:|...||:..|.. ..||:.||.|:.|.  
Zfish     5 CSASNC--TNRYNNKNPEITFHRFPFSKPSVLKQWLDNIGRDDFQPRKHMVICSLHFTPDCFS-- 65

  Fly    65 MQYELGFSRKN------PTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIGFD- 122
               .|| :|||      ||..   :.|:.:..|   ...|..:||..:|    .|.|...|..| 
Zfish    66 ---GLG-NRKNLLWNAVPTLF---AVPTQDANQ---NNFRKRLKRALQS----ASEKWDGITPDG 116

  Fly   123 ------PHHAGTQSSEGHETIEIQLCGFNTDIEGFEEAE-----DDDCPSGPRLVEVEILDP--- 173
                  ..|..||....:|..:.|    :|.:  |..|:     .|.|.:..||  ..|||.   
Zfish   117 LPLFTEEMHEDTQDCNNNEVADCQ----STKV--FAAADHTYALSDACTTKARL--FNILDANRW 173

  Fly   174 LNPQSNAKDHVEIIDSEGDSYVKHLELEICSLKREVFFLKDE 215
            |..:..||..|          :|.::|::...:||:..|:.:
Zfish   174 LRKRLQAKCRV----------IKRMKLKLKDAQRELLTLRQQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 32/93 (34%)
GrpE 198..>239 CDD:295646 4/18 (22%)
thap3NP_001014316.1 THAP 4..82 CDD:283206 31/84 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.