DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and thap12b

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001002680.1 Gene:thap12b / 436953 ZFINID:ZDB-GENE-040718-429 Length:746 Species:Danio rerio


Alignment Length:249 Identity:49/249 - (19%)
Similarity:86/249 - (34%) Gaps:80/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTA-------CICNEHFAPND 60
            ||..||   .|.:.::...:|.||::....:.|::.|:|.::...|.       .:|.:||.|..
Zfish     5 CAAPNC---TRKSTQSDLAFFRFPRDPERCRLWVENCRRADLEEKTPDQLNKHYRLCAKHFEPAM 66

  Fly    61 FERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIGFD-PH 124
            ..:...|.        |.|:..:.|::                                 || ..
Zfish    67 ICKTSPYR--------TVLRDTAIPTI---------------------------------FDLTS 90

  Fly   125 HAGTQSSEGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDS 189
            |.|...|...:.|::..   :.:::..:|          |.:|..|.......|:|:|     ||
Zfish    91 HLGNPHSRHRKRIKVLT---DEEVQKIKE----------RRLESSIEQLSKKDSDAQD-----DS 137

  Fly   190 EGDSYVKHLELEICSLKREVFFLKDEYQKIKAEMR-------NLKDTIKRSEEE 236
            |....|..|..|...|:.   |||..::.:....|       |.::...||:||
Zfish   138 ETTDDVPRLTPEQKDLRE---FLKSSFEVMILIGRQSFPYSSNAREDEMRSKEE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 20/91 (22%)
GrpE 198..>239 CDD:295646 12/46 (26%)
thap12bNP_001002680.1 THAP 5..87 CDD:283206 20/125 (16%)
DUF4371 <149..327 CDD:290989 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.