Sequence 1: | NP_001261721.1 | Gene: | CG14135 / 39316 | FlyBaseID: | FBgn0036193 | Length: | 259 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005564.1 | Gene: | Thap4 / 363291 | RGDID: | 1359473 | Length: | 569 | Species: | Rattus norvegicus |
Alignment Length: | 398 | Identity: | 78/398 - (19%) |
---|---|---|---|
Similarity: | 122/398 - (30%) | Gaps: | 180/398 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 CAVKNCGNNNRIANRTKWRYFHFP-KEKPNLQRWIDFCQRDNINPTT-ACICNEHFAPNDFERNM 65
Fly 66 --QYELGFSRKNPTKLKPGSFPSV------------NGP--QKLAKELRG--------------- 99
Fly 100 ---------------------------------------SIKR--GSKSVPLA------------ 111
Fly 112 -----------------------------GSTKMSNIG------FDPHHAGTQSSEGHETIEIQL 141
Fly 142 CGFNTDIE----GFEEAED-------------DDCPSGP----------RLVEVEILDPLNPQS- 178
Fly 179 -----NAKDHVEIIDSEGDSY---VKHLELEICSLKREVFFLKDEYQKIKAEMRNLKDTIKRSEE 235
Fly 236 E---LAEK 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14135 | NP_001261721.1 | THAP | 2..88 | CDD:283206 | 28/100 (28%) |
GrpE | 198..>239 | CDD:295646 | 9/43 (21%) | ||
Thap4 | NP_001005564.1 | THAP | 4..86 | CDD:283206 | 28/89 (31%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 83..219 | 12/135 (9%) | |||
HCFC1-binding motif (HBM). /evidence=ECO:0000250|UniProtKB:Q8WTV1 | 230..233 | 0/2 (0%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 235..312 | 15/79 (19%) | |||
Nitrobindin. /evidence=ECO:0000250|UniProtKB:Q8WY91 | 407..569 | ||||
DUF1794 | 414..566 | CDD:285921 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |