DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and AgaP_AGAP005572

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_556218.3 Gene:AgaP_AGAP005572 / 3290000 VectorBaseID:AGAP005572 Length:524 Species:Anopheles gambiae


Alignment Length:123 Identity:30/123 - (24%)
Similarity:47/123 - (38%) Gaps:36/123 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCG-NNNRIANRTKWRYFH-FPKEKPNLQRWIDFC-QRDNIN-PTTACICNEHFAPNDF-- 61
            |:|.:|. |..|:.:......|| ||.:....|:|.:|| |..|.. |....:|:.||..:|:  
Mosquito     5 CSVASCTFNRERVKSLQLDIIFHKFPTDPLLKQKWHEFCKQGPNWKPPKNGLVCSNHFTKDDYQM 69

  Fly    62 ------ERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGS 113
                  :.|..|.:         ||..:.||:               |....:|:|.|
Mosquito    70 TRSPLLQANRLYRM---------LKINAVPSI---------------RNGVPIPIATS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 26/96 (27%)
GrpE 198..>239 CDD:295646
AgaP_AGAP005572XP_556218.3 THAP 5..95 CDD:283206 27/113 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008566
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.