DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and AgaP_AGAP006428

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_316465.2 Gene:AgaP_AGAP006428 / 1277039 VectorBaseID:AGAP006428 Length:1117 Species:Anopheles gambiae


Alignment Length:222 Identity:47/222 - (21%)
Similarity:70/222 - (31%) Gaps:74/222 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RCAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQ-RDNINPTTAC-ICNEHFAPNDFERN 64
            :|.|..|.:::.........|...|......:.||..|. .|:...|.|. :|:.||...||:. 
Mosquito     5 KCIVPECPSSSARPEDRGVTYHKIPYLDEMKRLWIVACHLPDDYFATKASNVCSRHFRRADFQE- 68

  Fly    65 MQYELGFSRKNPTKLKPGSFPSVNGPQKLAK---ELRGSIKRGSKSVPLAGSTKMSNIGFDPHHA 126
                  |..|... ||.|..|:| .|..:.|   |...|.|...|..|                .
Mosquito    69 ------FKGKKYV-LKLGVVPTV-FPWTVTKPPGEAGSSTKSPQKPAP----------------K 109

  Fly   127 GTQSSEGHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDHVEIIDSEG 191
            |...::|.:.               ||.||.:.|.                       |:.|.:|
Mosquito   110 GKDDAKGAKV---------------EETEDGEVPH-----------------------EVGDMDG 136

  Fly   192 DSYVKHLELEICSLKREVFFLKDEYQK 218
            |..||. :.::.:|.:     .|:.||
Mosquito   137 DIVVKE-DAKVTALLK-----SDQAQK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 22/87 (25%)
GrpE 198..>239 CDD:295646 4/21 (19%)
AgaP_AGAP006428XP_316465.2 THAP 5..87 CDD:283206 23/90 (26%)
Neuromodulin 93..275 CDD:284117 22/125 (18%)
TEBP_beta <137..238 CDD:254188 7/27 (26%)
Agenet 249..304 CDD:283330
TUDOR 312..361 CDD:197660
MeCP2_MBD 456..530 CDD:238690
PHD_SF 857..901 CDD:304600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.