DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and AgaP_AGAP009530

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_310159.2 Gene:AgaP_AGAP009530 / 1271378 VectorBaseID:AGAP009530 Length:193 Species:Anopheles gambiae


Alignment Length:220 Identity:47/220 - (21%)
Similarity:78/220 - (35%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRY-----FH-FPKEKPN-LQRWIDFCQRD-NINPTT-ACICNEHFAP 58
            |.:.:|.        .|:.:     || ||.:.|. |::||.|..|| :.:||. :.:|:.||..
Mosquito     5 CVIPDCD--------LKYTHSDDVSFHKFPLKSPELLKQWIQFTGRDESWHPTKWSALCSRHFVA 61

  Fly    59 NDFERNMQYELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIGFDP 123
            :||:.....::         |.|.:.|||.      ..:....:..:.|:|:.            
Mosquito    62 SDFKGCAARKI---------LLPTAVPSVR------NAVAAKAQPNNLSLPVI------------ 99

  Fly   124 HHAGTQSSEGHETIEIQLC-----GFNTDIEGFEEAEDDDCPSGPR---LVEVEILDPLNPQSNA 180
                     .:||:    |     ..|...|.:...|.|..|.|..   ||..|.:|...|    
Mosquito   100 ---------SYETV----CPEEERSHNRHFEHYLPVELDYAPFGGTLCPLVASEQVDEFGP---- 147

  Fly   181 KDHVEIIDSEGDSYVKHLELEICSL 205
                  .|::||..:..:...||.:
Mosquito   148 ------ADADGDVQLIEITCRICGV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 25/93 (27%)
GrpE 198..>239 CDD:295646 2/8 (25%)
AgaP_AGAP009530XP_310159.2 THAP 4..82 CDD:214951 25/93 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.