DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14135 and si:ch73-382f3.1

DIOPT Version :9

Sequence 1:NP_001261721.1 Gene:CG14135 / 39316 FlyBaseID:FBgn0036193 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001243612.1 Gene:si:ch73-382f3.1 / 100151273 ZFINID:ZDB-GENE-030131-9513 Length:283 Species:Danio rerio


Alignment Length:270 Identity:52/270 - (19%)
Similarity:90/270 - (33%) Gaps:89/270 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CAVKNCGNNNRIANRTKWRYFHFPKEKPNLQRWIDFCQRDNINPTTACICNEHFAPNDFERNMQY 67
            |:..||.|:..|..    :.|.|||:...:::|:..|:||.:....:.:|.:||..:.||     
Zfish     4 CSAPNCSNSTTIGK----QLFRFPKDPVRMRKWLVNCRRDFVPTPCSRLCQDHFEESQFE----- 59

  Fly    68 ELGFSRKNPTKLKPGSFPSVNGPQKLAKELRGSIKRGSKSVPLAGSTKMSNIGFDPHHAGTQSSE 132
            |:..|.....||||.:.|::                                             
Zfish    60 EIARSPAGGRKLKPNAIPTL--------------------------------------------- 79

  Fly   133 GHETIEIQLCGFNTDIEGFEEAEDDDCPSGPRLVEVEILDPLNPQSNAKDH-----VEIIDSEGD 192
                       ||        ..|...|..|:.|.....:|:..:.|..||     ...:|||.|
Zfish    80 -----------FN--------VPDPPSPVTPQAVLPVKNEPVEKELNMGDHGYARRQPPVDSEED 125

  Fly   193 SYVKHLELEICSL-----------KREVFFLKDEYQKIKAEMRNLKDTIKRSEEELAEKQLQGVV 246
            ...:..|...|||           ::....|:.|.:::|..:..|....|..:..|.|.|::.:.
Zfish   126 GVQRAEEERPCSLCQHYKTKLEQQQQHTVRLQREAEEMKKRLYKLSKIEKGLQVFLFEDQIRALT 190

  Fly   247 KSRKVGLRFW 256
            .:::.....|
Zfish   191 LAKRSRRAVW 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14135NP_001261721.1 THAP 2..88 CDD:283206 25/84 (30%)
GrpE 198..>239 CDD:295646 10/51 (20%)
si:ch73-382f3.1NP_001243612.1 THAP 4..81 CDD:283206 25/141 (18%)
Tnp_P_element 146..>259 CDD:288840 9/55 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11471
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40446
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17357
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.