DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sugb and GDS1

DIOPT Version :9

Sequence 1:NP_648493.3 Gene:Sugb / 39314 FlyBaseID:FBgn0036191 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_015000.3 Gene:GDS1 / 854537 SGDID:S000005882 Length:522 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:50/273 - (18%)
Similarity:82/273 - (30%) Gaps:90/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 ILPIIGMLAKPLFGYIADRYHRHRPLFLGGQVLTGIAFFLIMFVPGMEKPLPKVEFHCH---QGV 111
            ::|:.|...||        .:|..|  |...||.  |.|||::.....:....|:..|.   |..
Yeast    97 LIPVTGERPKP--------ENRDSP--LDDDVLH--AVFLILWEMDPNQQGMTVKQLCDLLLQKH 149

  Fly   112 SDIPRFCSEYGECVERNLERYY-----GNRTLECELNCEAQPFMWD-------------IVCEDW 158
            .|:....::....:...|..|.     |.:||...|:.|     |.             |:..|:
Yeast   150 PDMSNLSTKLSNLISAKLNAYVKKIEKGEKTLTYALSRE-----WSNSSPRRMLYIYRGILSPDY 209

  Fly   159 ----------LKNNTE----------------NCAANRTNTQMEFGASIT----------MQKIE 187
                      ||...|                ..::|:......:.:|:|          ..|..
Yeast   210 KEHAQAVTMQLKQQLETSGDTSDFNSNGKKKRESSSNQLVNNDSYSSSMTDMKNMSSNSSFSKNL 274

  Fly   188 NDGSCMF-----FMIPHDQGQI--------AGQNVTLYCPKEKEYFKSNCTMDCREDYLKEQLAE 239
            |.|:..|     |.||:....:        :.....|..|......|:|   :.:.:|:.|...|
Yeast   275 NVGNLAFSLSPEFNIPYSTSPVSLNLSPSMSNNQQQLLTPNSASKSKNN---NKKRNYMDEDTNE 336

  Fly   240 SAVINTSSAVTMP 252
            |......:..|.|
Yeast   337 SMTEPKKTKTTKP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SugbNP_648493.3 MFS 9..82 CDD:304372 7/31 (23%)
MFS_1 16..>96 CDD:284993 13/45 (29%)
MFS_1 <252..518 CDD:284993 1/1 (100%)
MFS <254..547 CDD:119392
GDS1NP_015000.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.