powered by:
Protein Alignment Sugb and Spf45
DIOPT Version :9
Sequence 1: | NP_648493.3 |
Gene: | Sugb / 39314 |
FlyBaseID: | FBgn0036191 |
Length: | 604 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001036426.1 |
Gene: | Spf45 / 3355114 |
FlyBaseID: | FBgn0086683 |
Length: | 403 |
Species: | Drosophila melanogaster |
Alignment Length: | 39 |
Identity: | 10/39 - (25%) |
Similarity: | 14/39 - (35%) |
Gaps: | 16/39 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 PIIGMLAKPLFG----------------YIADRYHRHRP 74
||..:::|||.. .:||.|...||
Fly 62 PITTVVSKPLISGKALPSILERINRGDWDVADEYDPQRP 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.78878 |
Normalized mean entropy |
S3904 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.