DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sugb and hpx-2

DIOPT Version :9

Sequence 1:NP_648493.3 Gene:Sugb / 39314 FlyBaseID:FBgn0036191 Length:604 Species:Drosophila melanogaster
Sequence 2:NP_506432.1 Gene:hpx-2 / 179880 WormBaseID:WBGene00008627 Length:718 Species:Caenorhabditis elegans


Alignment Length:72 Identity:18/72 - (25%)
Similarity:30/72 - (41%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 LSGW--ILKKIGHVNAM-SVVLFGFGVR---FILYSMLQNPWYILPIELMNGVTFGLFYATMASY 488
            :.||  ::..:..:.|| |...|.||:|   |.:.....:...::.|.:..|...|||  ....|
 Worm   514 IGGWEPVMNGMVRMPAMKSDRYFSFGIRNQMFEIRGRNGSGVDLVSINIQRGRDMGLF--PYIQY 576

  Fly   489 ASIVAPP 495
            ..:|..|
 Worm   577 RQLVGLP 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SugbNP_648493.3 MFS 9..82 CDD:304372
MFS_1 16..>96 CDD:284993
MFS_1 <252..518 CDD:284993 18/72 (25%)
MFS <254..547 CDD:119392 18/72 (25%)
hpx-2NP_506432.1 An_peroxidase 158..696 CDD:376988 18/72 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.78878 Normalized mean entropy S3904
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.