DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sugb and skpo-1

DIOPT Version :9

Sequence 1:	NP_648493.3	Gene:	Sugb / 39314	FlyBaseID:	FBgn0036191	Length:	604	Species:	Drosophila melanogaster
Sequence 2:	NP_495768.1	Gene:	skpo-1 / 174340	WormBaseID:	WBGene00009897	Length:	655	Species:	Caenorhabditis elegans

Alignment Length:	109	Identity:	24/109 - (22%)
Similarity:	48/109 - (44%)	Gaps:	30/109 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   439 GHVNAMSVVLFGFGVRFILYSMLQNPWYILPIELMNGVTFGLFYATMASYASIVAPPGTDATMQS 503
            ||||:: ::|||   :|:.:.:..|.          ...|.....:....|||.||| :|.:.:.
Worm   207 GHVNSL-LMLFG---QFVSHDITSNA----------AQNFCGCQNSGPMCASIFAPP-SDRSRRC 256

  Fly   504 L-------------VGAIFEGVGVSMGSLIAGQLF--ESVTART 532
            :             .|.:.|.:.::..::.|..::  |::|||:
Worm   257 IPFTRSFPICGTGQFGRVREQLNMNTAAIDASLIYGSEAITARS 300

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sugb	NP_648493.3	MFS	9..82	CDD:304372
		MFS_1	16..>96	CDD:284993
		MFS_1	<252..518	CDD:284993	19/91 (21%)
		MFS	<254..547	CDD:119392	24/109 (22%)
skpo-1	NP_495768.1	ShKT	22..56	CDD:214586
		An_peroxidase	143..623	CDD:281139	24/109 (22%)
		peroxinectin_like	275..619	CDD:188655	6/26 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0.78878	Normalized mean entropy	S3904
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950