DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and VFB1

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_175151.1 Gene:VFB1 / 841121 AraportID:AT1G47056 Length:518 Species:Arabidopsis thaliana


Alignment Length:446 Identity:111/446 - (24%)
Similarity:162/446 - (36%) Gaps:148/446 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 PIHSIEQLM--------LDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQC 332
            ||.|||..:        |.|..|:..||:.:...|:..|.||.:|. .:....||          
plant    26 PIESIESEISQPDYTSSLPDECLALVFQFLNSGNRKRCALVCRRWM-IVEGQNRY---------- 79

  Fly   333 RELRQMPGCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHSFP-LASK--HVHSLSLRCS---- 390
                               |...||..          |::.|.| |.|:  .|..|||:|.    
plant    80 -------------------RLSLHARS----------DLITSIPSLFSRFDSVTKLSLKCDRRSV 115

  Fly   391 SISDRGLETLLDHLQSLFELELAGCNEVTEAGLWA----CLTPRIVSLSLAD------------C 439
            ||.|..|..:....::|..|:|..|.|:|:.|:.|    |...:|.|....|            |
plant   116 SIGDEALVKISLRCRNLKRLKLRACRELTDVGMAAFAENCKDLKIFSCGSCDFGAKGVKAVLDHC 180

  Fly   440 IN--------------IADEAVGAVAQLLPSLYEFSLQAYHVTDAALGY-FSP-----KQSHSLS 484
            .|              ||.|.:|      |.:...||::..:.:...|. |.|     |...||.
plant   181 SNLEELSIKRLRGFTDIAPEMIG------PGVAASSLKSICLKELYNGQCFGPVIVGAKNLKSLK 239

  Fly   485 ILRLQSCWEL-------TNHGIVNIVH----SLPHLTVLSLSGCSKL-----------TDDGVEL 527
            :.|....|:|       .:||:|.| |    .:..:.:.::|.||.|           |:.|:..
plant   240 LFRCSGDWDLLLQEMSGKDHGVVEI-HLERMQVSDVALSAISYCSSLESLHLVKTPECTNFGLAA 303

  Fly   528 IAENLQKLRALDL-SW-CPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALF 590
            |||..::||.|.: .| ...|.|..|..:|...:||:||.|          :|...|.|||..|.
plant   304 IAEKCKRLRKLHIDGWKANLIGDEGLVAVAKFCSQLQELVL----------IGVNPTTLSLGMLA 358

  Fly   591 LRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSL-IQLRHLQELELTNCP 645
            .:             |  .||:.|:|.||.......||.: .:...|::|.:.|||
plant   359 AK-------------C--LNLERLALCGCDTFGDPELSCIAAKCPALRKLCIKNCP 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 9/27 (33%)
AMN1 383..600 CDD:187754 71/280 (25%)
leucine-rich repeat 431..456 CDD:275381 9/50 (18%)
leucine-rich repeat 457..482 CDD:275381 6/30 (20%)
leucine-rich repeat 483..508 CDD:275381 9/35 (26%)
leucine-rich repeat 509..534 CDD:275381 9/35 (26%)
leucine-rich repeat 535..560 CDD:275381 8/26 (31%)
leucine-rich repeat 561..585 CDD:275381 6/23 (26%)
leucine-rich repeat 586..610 CDD:275381 3/23 (13%)
leucine-rich repeat 636..661 CDD:275381 5/10 (50%)
VFB1NP_175151.1 F-box-like 41..>70 CDD:403981 9/28 (32%)
AMN1 87..>202 CDD:187754 31/124 (25%)
leucine-rich repeat 103..125 CDD:275381 9/21 (43%)
leucine-rich repeat 132..157 CDD:275381 9/24 (38%)
leucine-rich repeat 158..182 CDD:275381 4/23 (17%)
leucine-rich repeat 183..224 CDD:275381 8/46 (17%)
leucine-rich repeat 235..260 CDD:275381 5/24 (21%)
leucine-rich repeat 261..284 CDD:275381 5/23 (22%)
AMN1 271..>412 CDD:187754 42/154 (27%)
leucine-rich repeat 285..310 CDD:275381 6/24 (25%)
leucine-rich repeat 311..338 CDD:275381 8/26 (31%)
leucine-rich repeat 339..363 CDD:275381 11/48 (23%)
leucine-rich repeat 364..389 CDD:275381 7/24 (29%)
leucine-rich repeat 390..414 CDD:275381 5/10 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.