DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT5G67140

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_201515.1 Gene:AT5G67140 / 836849 AraportID:AT5G67140 Length:228 Species:Arabidopsis thaliana


Alignment Length:188 Identity:45/188 - (23%)
Similarity:82/188 - (43%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 LDHLQSLFELE-----LAGCNEVTEAGLWACLTPRIVSLSLA--DCINIA-----DEAVGAVAQL 453
            ||.|..:|.|.     ||..:.|.:.  |.    :.|:.|:|  :.::.|     |::...:..|
plant    12 LDLLAYIFSLATSFTVLAQASGVCKK--WR----KAVNQSMARRETLSFAGWKMDDDSTSRLVHL 70

  Fly   454 LPSLYEFSLQ----AYHVTDAALGYFSPKQSHSLSILRLQSCW---ELTNHGIVNIV---HSLPH 508
            ..:|.|..:.    ..|:||.  |.:....:..:|.|...|.|   .:|:.|:|.::   .||.|
plant    71 AFNLKELDISRSRWGCHITDN--GLYQIASARCVSNLNSVSLWGMTAITDSGVVQLISRTSSLQH 133

  Fly   509 LTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTL 566
            |.:    |.:.:||:.:..|||...:|:.:.:..|..:|:..|..:.....:||.:.|
plant   134 LNI----GGTFITDESLFAIAERCHQLKTIGMWCCRHVTERGLLVLVNKCRKLESINL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 3/4 (75%)
AMN1 383..600 CDD:187754 45/188 (24%)
leucine-rich repeat 431..456 CDD:275381 6/31 (19%)
leucine-rich repeat 457..482 CDD:275381 6/28 (21%)
leucine-rich repeat 483..508 CDD:275381 9/30 (30%)
leucine-rich repeat 509..534 CDD:275381 7/24 (29%)
leucine-rich repeat 535..560 CDD:275381 4/24 (17%)
leucine-rich repeat 561..585 CDD:275381 3/6 (50%)
leucine-rich repeat 586..610 CDD:275381
leucine-rich repeat 636..661 CDD:275381
AT5G67140NP_201515.1 F-box-like 7..>43 CDD:403981 9/36 (25%)
leucine-rich repeat 50..72 CDD:275381 3/21 (14%)
AMN1 <58..182 CDD:187754 29/129 (22%)
leucine-rich repeat 74..104 CDD:275381 6/31 (19%)
leucine-rich repeat 105..130 CDD:275381 6/24 (25%)
leucine-rich repeat 131..155 CDD:275381 9/27 (33%)
leucine-rich repeat 156..181 CDD:275381 4/24 (17%)
leucine-rich repeat 182..206 CDD:275381 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.