DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT5G51380

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_199951.1 Gene:AT5G51380 / 835212 AraportID:AT5G51380 Length:479 Species:Arabidopsis thaliana


Alignment Length:449 Identity:104/449 - (23%)
Similarity:160/449 - (35%) Gaps:139/449 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 LMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRY-----WSGLL--------PTLQCRE 334
            |.|.|..|.:..:.....:...::.||.:|.....|..|.     |..||        |.|...:
plant    65 LSLSDSLLLKILEKLPESQNEDVSLVCKRWLSVQGRRLRSMKVFDWEFLLSGRLVSRFPKLTSVD 129

  Fly   335 LRQM---PGCDRGKLY--------------------------NSLIRRGFHALGLVGASDEDALD 370
            |...   |..:.|.|.                          |.::.:|...||. |:.|...|.
plant   130 LVNACFNPSSNSGILLCHTSISFHVSTDSSLNLNFVEESLLDNEMVDKGLRVLGR-GSFDLIKLV 193

  Fly   371 VVHSFPLASKHVHSLSLRCSSISDRGLETLLDHL-------QSLFELELAG------CNEVTEAG 422
            |:::..|.   :.||:..||.:.:..|....|:|       ::|..|.|.|      .:.|::.|
plant   194 VINATELG---LLSLAEDCSDLQELELHKCSDNLLRGIAACENLRGLRLVGSVDGLYSSSVSDIG 255

  Fly   423 L----WACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTD---AALGYFSPKQS 480
            |    ..|  .|:|.|.|:.|....| .:.|:.|....|.|.|:..:.:.|   |||.||     
plant   256 LTILAQGC--KRLVKLELSGCEGSFD-GIKAIGQCCEVLEELSICDHRMDDGWIAALSYF----- 312

  Fly   481 HSLSILRLQSCWEL-TNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCP 544
            .||..|.:.||.:: ::.|...::.|.|.|..|.|..|.....:|          :|||      
plant   313 ESLKTLLISSCRKIDSSPGPGKLLGSCPALESLQLRRCCLNDKEG----------MRAL------ 361

  Fly   545 RITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMR 609
                    :..||                           .:|.:.::.|..:.|.......:.|
plant   362 --------FKVCD---------------------------GVTKVNIQDCWGLDDDSFSLAKAFR 391

  Fly   610 NLQVLSLAGCPLLTSSGLSSLIQLRHLQELE---LTNC--------PGASHELFDYLKE 657
            .::.|||.||.:||:|||.|:|  .|.:|||   :.:|        ..|...||..|||
plant   392 RVRFLSLEGCSILTTSGLESVI--LHWEELESMRVVSCKNIKDSEISAALSSLFSLLKE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/30 (23%)
AMN1 383..600 CDD:187754 52/237 (22%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 9/27 (33%)
leucine-rich repeat 483..508 CDD:275381 6/25 (24%)
leucine-rich repeat 509..534 CDD:275381 5/24 (21%)
leucine-rich repeat 535..560 CDD:275381 5/24 (21%)
leucine-rich repeat 561..585 CDD:275381 0/23 (0%)
leucine-rich repeat 586..610 CDD:275381 3/23 (13%)
leucine-rich repeat 636..661 CDD:275381 10/33 (30%)
AT5G51380NP_199951.1 AMN1 208..405 CDD:187754 57/255 (22%)
leucine-rich repeat 212..233 CDD:275381 3/20 (15%)
leucine-rich repeat 234..265 CDD:275381 8/32 (25%)
leucine-rich repeat 266..290 CDD:275381 7/24 (29%)
leucine-rich repeat 291..314 CDD:275381 9/27 (33%)
leucine-rich repeat 315..341 CDD:275381 6/25 (24%)
leucine-rich repeat 342..367 CDD:275381 10/75 (13%)
leucine-rich repeat 393..418 CDD:275381 13/26 (50%)
leucine-rich repeat 419..442 CDD:275381 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2642
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.