DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT5G51370

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001032056.1 Gene:AT5G51370 / 835211 AraportID:AT5G51370 Length:446 Species:Arabidopsis thaliana


Alignment Length:479 Identity:107/479 - (22%)
Similarity:164/479 - (34%) Gaps:162/479 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 IMQHQLHPPPIHSIE------QLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSG 325
            :..|..:..|.:||:      .|.|.|..|.:..:.....:...::.||.:|.:           
plant     8 VQNHIKNEKPFNSIKPSEIDSTLSLSDSLLLKIIEKLPESQSNDVSLVCKRWLN----------- 61

  Fly   326 LLPTLQCRELRQMPGCDRGKLYNSLIRRGFHAL---GLVGASDEDALD----VVH---SFPLASK 380
                ||.:.||.:...|...|.:..:...|..|   .||.|.....::    ..|   ||.|:|.
plant    62 ----LQGQRLRSLKLLDFDFLLSERLTTRFPNLTHVDLVNACMNPRVNSGILFCHKSISFHLSSD 122

  Fly   381 H----------VHS-----------------LSLRCSSISDRGLETLLDHLQSLFELELAGCNEV 418
            .          :||                 |:|:..:.|:.||.:|......|.||||..||:.
plant   123 SSNWEFLEENLLHSDVIDRGLRILSRESFDLLNLKVINASELGLLSLAGDCSDLQELELHKCNDN 187

  Fly   419 TEAGLWACLTPR------------------------------IVSLSLADCINIADEAVGAVAQL 453
            ...|:.||...:                              :|.|.|:.|....| .:.|:.|.
plant   188 LLHGIAACKNLKGLRLVGSVDGLYSSSVSDIGLTFLAQGCRSLVKLELSGCEGSFD-GIKAIGQC 251

  Fly   454 LPSLYEFSLQAYHVTD---AALGYFSPKQSHSLSILRLQSCWEL-TNHGIVNIVHSLPHLTVLSL 514
            ...|.|.|:..:.:.|   |||.||     .||.|||:.||.:: .:.|...::.|.|.:..|.|
plant   252 CEVLEELSICDHRMDDGWIAALSYF-----ESLKILRISSCRKIDASPGPEKLLRSCPAMESLQL 311

  Fly   515 SGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGY 579
            ..|.....:|::.:                        :..||  ...|:.:..|..::|     
plant   312 KRCCLNDKEGIKAL------------------------FKVCD--GATEVNIQDCWGLSD----- 345

  Fly   580 ISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRHLQELE---L 641
              ...||...|                  |.::.|||.||.:|||.||.|:|  .|.:|||   :
plant   346 --DCFSLAKAF------------------RRVRFLSLEGCSVLTSGGLESVI--LHWEELESMRV 388

  Fly   642 TNCPG--------ASHELFDYLKE 657
            .:|..        |...||..|||
plant   389 VSCKSIKDSEISPALSSLFSLLKE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 8/40 (20%)
AMN1 383..600 CDD:187754 56/267 (21%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 9/27 (33%)
leucine-rich repeat 483..508 CDD:275381 8/25 (32%)
leucine-rich repeat 509..534 CDD:275381 4/24 (17%)
leucine-rich repeat 535..560 CDD:275381 2/24 (8%)
leucine-rich repeat 561..585 CDD:275381 3/23 (13%)
leucine-rich repeat 586..610 CDD:275381 2/23 (9%)
leucine-rich repeat 636..661 CDD:275381 10/33 (30%)
AT5G51370NP_001032056.1 AMN1 115..290 CDD:187754 45/180 (25%)
leucine-rich repeat 149..175 CDD:275381 6/25 (24%)
leucine-rich repeat 176..197 CDD:275381 10/20 (50%)
leucine-rich repeat 198..229 CDD:275381 0/30 (0%)
leucine-rich repeat 230..254 CDD:275381 7/24 (29%)
leucine-rich repeat 255..278 CDD:275381 9/27 (33%)
AMN1 <273..405 CDD:187754 44/189 (23%)
leucine-rich repeat 279..305 CDD:275381 8/25 (32%)
leucine-rich repeat 306..331 CDD:275381 6/50 (12%)
leucine-rich repeat 357..382 CDD:275381 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2642
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.