DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AFB5

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_568718.1 Gene:AFB5 / 835062 AraportID:AT5G49980 Length:619 Species:Arabidopsis thaliana


Alignment Length:466 Identity:91/466 - (19%)
Similarity:148/466 - (31%) Gaps:184/466 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 IEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGL-LPTLQCRELRQMPGCDR 343
            ::::.:.|..|:.....|..::..||  ||.:...|        ||: :...:||:|:       
plant   157 LKRMFVTDDDLALLADSFPGFKELIL--VCCEGFGT--------SGISIVANKCRKLK------- 204

  Fly   344 GKLYNSLIRRGFHALGLVGAS-DEDALDVVHSFPLASKHVHSLSLRC--SSISDRGLETL----- 400
                         .|.|:.:. .:|.:|.:..||.....:.||:..|  :.|:.:.||.|     
plant   205 -------------VLDLIESEVTDDEVDWISCFPEDVTCLESLAFDCVEAPINFKALEGLVARSP 256

  Fly   401 ------LDHLQSLFELE--LAGCNEVTEAG---------------------LWAC---------- 426
                  |:...||.||.  |.|..::|..|                     ..||          
plant   257 FLKKLRLNRFVSLVELHRLLLGAPQLTSLGTGSFSHDEEPQSEQEPDYAAAFRACKSVVCLSGFR 321

  Fly   427 -LTPRIVSLSLADCIN----------------------------------IADEAVGAVAQLLPS 456
             |.|..:......|.|                                  |.||.:.|||.....
plant   322 ELMPEYLPAIFPVCANLTSLNFSYANISPDMFKPIILNCHKLQVFWALDSICDEGLQAVAATCKE 386

  Fly   457 LYEFSLQAYHVTDAALGYFSP--KQSHSLSILRLQS----CWELTNHGIVNIVHSLPHLTVLSLS 515
            |.|..:..:...:.:.|..|.  .|:.|....:|:|    |..:||..::.:..:.|.|||..| 
plant   387 LRELRIFPFDPREDSEGPVSELGLQAISEGCRKLESILYFCQRMTNAAVIAMSENCPELTVFRL- 450

  Fly   516 GC-----------SKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRC 569
             |           .|..|:|...|.:|.:||..|.:|..  :||.:..|:.              
plant   451 -CIMGRHRPDHVTGKPMDEGFGAIVKNCKKLTRLAVSGL--LTDQAFRYMG-------------- 498

  Fly   570 VHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLR 634
                    .|...:.:|:..|    :...|..|:|:          |.|||              
plant   499 --------EYGKLVRTLSVAF----AGDSDMALRHV----------LEGCP-------------- 527

  Fly   635 HLQELELTNCP 645
            .||:||:.:.|
plant   528 RLQKLEIRDSP 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 8/36 (22%)
AMN1 383..600 CDD:187754 60/314 (19%)
leucine-rich repeat 431..456 CDD:275381 8/58 (14%)
leucine-rich repeat 457..482 CDD:275381 5/26 (19%)
leucine-rich repeat 483..508 CDD:275381 5/28 (18%)
leucine-rich repeat 509..534 CDD:275381 10/35 (29%)
leucine-rich repeat 535..560 CDD:275381 6/24 (25%)
leucine-rich repeat 561..585 CDD:275381 1/23 (4%)
leucine-rich repeat 586..610 CDD:275381 5/23 (22%)
leucine-rich repeat 636..661 CDD:275381 5/10 (50%)
AFB5NP_568718.1 leucine-rich repeat 152..172 CDD:275381 2/14 (14%)
AMN1 <162..283 CDD:187754 33/150 (22%)
leucine-rich repeat 177..202 CDD:275381 8/34 (24%)
leucine-rich repeat 203..257 CDD:275381 14/73 (19%)
leucine-rich repeat 258..281 CDD:275381 7/22 (32%)
leucine-rich repeat 282..333 CDD:275381 6/50 (12%)
leucine-rich repeat 338..362 CDD:275381 0/23 (0%)
leucine-rich repeat 363..386 CDD:275381 6/22 (27%)
AMN1 <384..538 CDD:187754 43/207 (21%)
leucine-rich repeat 387..419 CDD:275381 6/31 (19%)
leucine-rich repeat 420..444 CDD:275381 5/23 (22%)
leucine-rich repeat 445..479 CDD:275381 10/35 (29%)
leucine-rich repeat 480..503 CDD:275381 7/46 (15%)
leucine-rich repeat 504..528 CDD:275381 9/51 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.