DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT5G01720

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_568094.2 Gene:AT5G01720 / 831688 AraportID:AT5G01720 Length:665 Species:Arabidopsis thaliana


Alignment Length:393 Identity:101/393 - (25%)
Similarity:162/393 - (41%) Gaps:84/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QCRELRQM------PGCDRGKLYNSL-----IRRGFHALGLVGASDED--ALDVVHSFPLASK-- 380
            :|:.|..|      .||   |..|::     :..|...:||:....:|  .||:.: .|:..|  
plant   159 RCKMLTDMGIGCIAVGC---KKLNTVSLKWCVGVGDLGVGLLAVKCKDIRTLDLSY-LPITGKCL 219

  Fly   381 -------HVHSLSLR-CSSISDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLT--------- 428
                   |:..|.|. |..:.|..|::|....:||.:|:.:.|..:|..||.:.|:         
plant   220 HDILKLQHLEELLLEGCFGVDDDSLKSLRHDCKSLKKLDASSCQNLTHRGLTSLLSGAGYLQRLD 284

  Fly   429 ----PRIVSLSLA--------------DCINIADEAVGAVAQLLPSLYEFSL-QAYHVTDAALGY 474
                ..::||..|              |..::..:.:.|:..|..||.|.|| :...|||..|..
plant   285 LSHCSSVISLDFASSLKKVSALQSIRLDGCSVTPDGLKAIGTLCNSLKEVSLSKCVSVTDEGLSS 349

  Fly   475 FSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCS--------------------- 518
            ...|.. .|..|.:..|.:|:...|..|.:|.|.|..|.:..||                     
plant   350 LVMKLK-DLRKLDITCCRKLSRVSITQIANSCPLLVSLKMESCSLVSREAFWLIGQKCRLLEELD 413

  Fly   519 ----KLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGY 579
                ::.|:|::.|:..| .|.:|.|..|..|||..|.||....:.|.||.|.|.|.|||:|:..
plant   414 LTDNEIDDEGLKSISSCL-SLSSLKLGICLNITDKGLSYIGMGCSNLRELDLYRSVGITDVGIST 477

  Fly   580 IST-MLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSL-IQLRHLQELELT 642
            |:. .:.|..:.:.:|..:.|..|..|.....||.....|||.:||.||::: ::.:.|.:::|.
plant   478 IAQGCIHLETINISYCQDITDKSLVSLSKCSLLQTFESRGCPNITSQGLAAIAVRCKRLAKVDLK 542

  Fly   643 NCP 645
            .||
plant   543 KCP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 6/24 (25%)
AMN1 383..600 CDD:187754 69/271 (25%)
leucine-rich repeat 431..456 CDD:275381 6/38 (16%)
leucine-rich repeat 457..482 CDD:275381 9/25 (36%)
leucine-rich repeat 483..508 CDD:275381 7/24 (29%)
leucine-rich repeat 509..534 CDD:275381 8/49 (16%)
leucine-rich repeat 535..560 CDD:275381 10/24 (42%)
leucine-rich repeat 561..585 CDD:275381 11/24 (46%)
leucine-rich repeat 586..610 CDD:275381 5/23 (22%)
leucine-rich repeat 636..661 CDD:275381 4/10 (40%)
AT5G01720NP_568094.2 AMN1 60..>201 CDD:187754 10/44 (23%)
leucine-rich repeat 74..93 CDD:275381
leucine-rich repeat 101..126 CDD:275381
leucine-rich repeat 127..151 CDD:275381
leucine-rich repeat 152..172 CDD:275381 3/12 (25%)
leucine-rich repeat 178..203 CDD:275381 4/24 (17%)
AMN1 196..372 CDD:187754 41/177 (23%)
leucine-rich repeat 204..247 CDD:275381 10/43 (23%)
leucine-rich repeat 254..279 CDD:275381 7/24 (29%)
leucine-rich repeat 280..330 CDD:275381 6/49 (12%)
AMN1 <328..500 CDD:187754 50/173 (29%)
leucine-rich repeat 331..356 CDD:275381 9/25 (36%)
leucine-rich repeat 357..382 CDD:275381 7/24 (29%)
leucine-rich repeat 383..408 CDD:275381 4/24 (17%)
leucine-rich repeat 409..458 CDD:275381 14/49 (29%)
AMN1 <441..567 CDD:187754 36/105 (34%)
leucine-rich repeat 459..484 CDD:275381 11/24 (46%)
leucine-rich repeat 485..507 CDD:275381 5/21 (24%)
leucine-rich repeat 510..535 CDD:275381 9/24 (38%)
leucine-rich repeat 536..561 CDD:275381 4/10 (40%)
leucine-rich repeat 562..585 CDD:275381
leucine-rich repeat 586..609 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.