DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and GRH1

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_567255.1 Gene:GRH1 / 828045 AraportID:AT4G03190 Length:585 Species:Arabidopsis thaliana


Alignment Length:361 Identity:86/361 - (23%)
Similarity:134/361 - (37%) Gaps:109/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 DVVHSFPLASKHVHSLSLRC--SSISDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIV 432
            |.:..||.:|..:.||...|  |.:....||.|:....:|..|:|...  ||..||         
plant   170 DWLSYFPESSTSLVSLDFSCLDSEVKISDLERLVSRSPNLKSLKLNPA--VTLDGL--------- 223

  Fly   433 SLSLADCI-NIADEAVGA-VAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELT 495
             :||..|. .:.:...|: .|||.|..:....:|:.         :.||..|||.|     |::.
plant   224 -VSLLRCAPQLTELGTGSFAAQLKPEAFSKLSEAFS---------NCKQLQSLSGL-----WDVL 273

  Fly   496 NHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELI--AENLQKLRALDLSWCPRITDASLEYIACDL 558
            ...:..:....|.||.|:||..:....|.|||:  ...||||..:||     |.|..||.:|...
plant   274 PEYLPALYSVCPGLTSLNLSYATVRMPDLVELLRRCSKLQKLWVMDL-----IEDKGLEAVASYC 333

  Fly   559 NQLEEL-------TLDRC-VHITDIGVGYIS-------------TMLSLTALF-----------L 591
            .:|.||       .||.. :.:|:.|:.::|             ...:..|||           .
plant   334 KELRELRVFPSEPDLDATNIPLTEQGLVFVSKGCRKLESVLYFCVQFTNAALFTIARKRPNLKCF 398

  Fly   592 RWC-----------SQVRDFGLQHLC-SMRNLQVLSLAGCPLLTSSGL----------------- 627
            |.|           ::..|.|.:.:. ..|:|:.||::|  ||:....                 
plant   399 RLCVIEPFAPDYKTNEPLDKGFKAIAEGCRDLRRLSVSG--LLSDKAFKYIGKHAKKVRMLSIAF 461

  Fly   628 --SSLIQLRH-------LQELELTNCPGASHELFDY 654
              .|.:.|.|       |::||:.:||.....|.::
plant   462 AGDSDLMLHHLLSGCESLKKLEIRDCPFGDTALLEH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/25 (28%)
AMN1 383..600 CDD:187754 64/265 (24%)
leucine-rich repeat 431..456 CDD:275381 7/26 (27%)
leucine-rich repeat 457..482 CDD:275381 3/24 (13%)
leucine-rich repeat 483..508 CDD:275381 4/24 (17%)
leucine-rich repeat 509..534 CDD:275381 10/26 (38%)
leucine-rich repeat 535..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..585 CDD:275381 8/44 (18%)
leucine-rich repeat 586..610 CDD:275381 7/46 (15%)
leucine-rich repeat 636..661 CDD:275381 6/19 (32%)
GRH1NP_567255.1 F-box_5 4..43 CDD:408301
Transp_inhibit 62..108 CDD:408562
leucine-rich repeat 103..127 CDD:275381
AMN1 <112..267 CDD:187754 30/117 (26%)
leucine-rich repeat 128..153 CDD:275381
leucine-rich repeat 154..208 CDD:275381 11/37 (30%)
leucine-rich repeat 209..232 CDD:275381 10/34 (29%)
leucine-rich repeat 233..279 CDD:275381 13/59 (22%)
AMN1 280..488 CDD:187754 49/214 (23%)
leucine-rich repeat 287..311 CDD:275381 9/23 (39%)
leucine-rich repeat 312..335 CDD:275381 11/27 (41%)
leucine-rich repeat 336..369 CDD:275381 8/32 (25%)
leucine-rich repeat 370..394 CDD:275381 3/23 (13%)
leucine-rich repeat 395..429 CDD:275381 4/33 (12%)
leucine-rich repeat 430..453 CDD:275381 6/24 (25%)
leucine-rich repeat 454..478 CDD:275381 3/23 (13%)
leucine-rich repeat 479..498 CDD:275381 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.