DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and VFB3

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_567316.1 Gene:VFB3 / 826171 AraportID:AT4G07400 Length:554 Species:Arabidopsis thaliana


Alignment Length:454 Identity:106/454 - (23%)
Similarity:167/454 - (36%) Gaps:128/454 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 LDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLYNS 349
            |.|..||..||..:..:.:..:.||.:|             |....|||                
plant    77 LPDECLSLIFQSLTCADLKRCSLVCRRW-------------LTIEGQCR---------------- 112

  Fly   350 LIRRGFHALGLVGASDEDALDVVHS----FPLASKHVHSLSLRCSSISDRGLETLLDHLQSLFEL 410
                  |.|.|...|  |.:.|:.|    |...:|.|.....|...|.|.....:....::|..|
plant   113 ------HRLSLKAQS--DLISVIPSLFTRFDSVTKLVLRSDRRSLGICDNAFVMISVRCRNLTRL 169

  Fly   411 ELAGCNEVTEAGLWA----CLTPRIVSLS------------LADCINIAD------EAVGAVAQL 453
            :|.||.|:::.|:..    |.:.:.||..            |..|:.:.:      ..:||.|:|
plant   170 KLRGCPEISDLGIIGFTENCRSLKKVSFGSCGFGVKGMNALLNTCLGLEELSVKRLRGIGAGAEL 234

  Fly   454 L------PSLYEFSLQAYHVTDAALGYFSPKQS--HSLSILRLQSC---WELTNHGI---VNI-- 502
            :      .||....|:..|....    |:|..|  ..|.||::..|   |:.....:   ||.  
plant   235 IGPGGAAGSLKVICLKELHNGQC----FAPLLSGAKGLRILKIFRCSGDWDRVFEAVRDKVNAIV 295

  Fly   503 -VH----SLPHLTVLSLSGCSKL-----------TDDGVELIAENLQKLRALDL-SW-CPRITDA 549
             :|    .:..|.:.:||.||.:           |:.|:.|:||..:.||.|.: .| ..||.|.
plant   296 EIHLERIQMSDLGLTALSKCSGVEVLHLVKTPDCTNVGLALVAERCKLLRKLHIDGWKTNRIGDE 360

  Fly   550 SLEYIACDLNQLEELTLDRCVHITDIGV--------GYISTMLSLTALFLRWCSQVRDFGLQHLC 606
            .|..:|.....|:||.|        |||        ..:|..|:|..|.|.....|.|   ..||
plant   361 GLIVVAKYCWNLQELVL--------IGVNPTKLSLEAIVSNCLNLERLALCGSDTVGD---TELC 414

  Fly   607 SMRN----LQVLSLAGCPLLTSSGLSSLIQ-LRHLQELELTNCPGASHELFDYLKEHLPRCLII 665
            .:..    |:.|.:..|| :|..|:.:|.. ..:|.::::..|.|.:.:..|.|::.  |.|::
plant   415 CIAEKCLALRKLCIKNCP-ITDDGIKALGNGCPNLLKVKVKKCRGVTTQGADLLRKR--RALLV 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 4/23 (17%)
AMN1 383..600 CDD:187754 66/280 (24%)
leucine-rich repeat 431..456 CDD:275381 8/48 (17%)
leucine-rich repeat 457..482 CDD:275381 6/26 (23%)
leucine-rich repeat 483..508 CDD:275381 8/37 (22%)
leucine-rich repeat 509..534 CDD:275381 10/35 (29%)
leucine-rich repeat 535..560 CDD:275381 9/26 (35%)
leucine-rich repeat 561..585 CDD:275381 8/31 (26%)
leucine-rich repeat 586..610 CDD:275381 7/23 (30%)
leucine-rich repeat 636..661 CDD:275381 5/24 (21%)
VFB3NP_567316.1 F-box-like 74..>104 CDD:289689 8/26 (31%)
leucine-rich repeat 89..114 CDD:275381 7/59 (12%)
leucine-rich repeat 115..165 CDD:275381 12/51 (24%)
AMN1 <146..>226 CDD:187754 15/79 (19%)
leucine-rich repeat 166..191 CDD:275381 8/24 (33%)
leucine-rich repeat 192..216 CDD:275381 4/23 (17%)
leucine-rich repeat 268..293 CDD:275381 6/24 (25%)
leucine-rich repeat 294..317 CDD:275381 5/22 (23%)
leucine-rich repeat 318..343 CDD:275381 5/24 (21%)
AMN1 <340..>463 CDD:187754 35/134 (26%)
leucine-rich repeat 344..371 CDD:275381 9/26 (35%)
leucine-rich repeat 372..396 CDD:275381 8/31 (26%)
leucine-rich repeat 397..422 CDD:275381 7/27 (26%)
leucine-rich repeat 423..447 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.