DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and VFB2

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_566928.1 Gene:VFB2 / 824170 AraportID:AT3G50080 Length:522 Species:Arabidopsis thaliana


Alignment Length:438 Identity:101/438 - (23%)
Similarity:170/438 - (38%) Gaps:112/438 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 LDDRFLSRFFQYFSPYERRILAQVCIKW-------RDTLYRSPRYWSGLLPTLQC---------- 332
            |.|..|:..||:.|..:|:..:.|..:|       |..|....:  |.:||.|.|          
plant    44 LPDDCLAHIFQFLSAGDRKRCSLVSKRWLLVDGQNRHRLSLDAK--SEILPFLPCIFNRFDSVTK 106

  Fly   333 RELRQMPGCDRGKL-------------YNSLIR---RGFHALGLVGASDEDALDVVHSFPLASKH 381
            ..||    |||...             .::|||   ||...:..:|         :.||....|.
plant   107 LALR----CDRRSFSLSDEALFIVSIRCSNLIRVKLRGCREITDLG---------MESFARNCKS 158

  Fly   382 VHSLSLRCSSISDRGLETLLDHLQSLFELEL---AGCNEVTEAGLWACLTPRIVSLSLADCIN-- 441
            :..||....:...:|:..:|:|.:.|.||.|   .|.:|:.|. :...|:..:.|:.|.:.:|  
plant   159 LRKLSCGSCTFGAKGINAMLEHCKVLEELSLKRIRGLHELAEP-IKLSLSASLRSVFLKELVNGQ 222

  Fly   442 -----IADEAVGAVAQLL----------------PSLYEFSLQAYHVTDAALGYFSPKQSHSLSI 485
                 :|...:..|..:.                .||.|..|:...|||  :|.|...:..:|..
plant   223 VFGSLVATRTLKKVKIIRCLGNWDRVFEMNGNGNSSLTEIRLERLQVTD--IGLFGISKCSNLET 285

  Fly   486 LRLQSCWELTNHGIVNIVHSLPHLTVLSLSG--CSKLTDDGVELIAE---NLQKLRALDLSWCPR 545
            |.:....:.:|.|:.::|.....|..|.:.|  ..::.|.|:..:|:   |||:|..:.:.    
plant   286 LHIVKTPDCSNLGLASVVERCKLLRKLHIDGWRVKRIGDQGLMSVAKHCLNLQELVLIGVD---- 346

  Fly   546 ITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRN 610
            .|..||..||.:..:||.|.|.....|.|..:|.|:..          |..:|.|.::. |.:.:
plant   347 ATYMSLSAIASNCKKLERLALCGSGTIGDAEIGCIAEK----------CVTLRKFCIKG-CLISD 400

  Fly   611 LQVLSLA-GCPLLTSSGLSSLIQLRHLQELELTNCPGASHELFDYLKE 657
            :.|.:|| |||.|.              :|::..|...:.|:.::|:|
plant   401 VGVQALALGCPKLV--------------KLKVKKCSLVTGEVREWLRE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 5/23 (22%)
AMN1 383..600 CDD:187754 57/247 (23%)
leucine-rich repeat 431..456 CDD:275381 5/47 (11%)
leucine-rich repeat 457..482 CDD:275381 8/24 (33%)
leucine-rich repeat 483..508 CDD:275381 5/24 (21%)
leucine-rich repeat 509..534 CDD:275381 8/29 (28%)
leucine-rich repeat 535..560 CDD:275381 6/24 (25%)
leucine-rich repeat 561..585 CDD:275381 8/23 (35%)
leucine-rich repeat 586..610 CDD:275381 4/23 (17%)
leucine-rich repeat 636..661 CDD:275381 5/22 (23%)
VFB2NP_566928.1 F-box-like 42..>71 CDD:403981 8/26 (31%)
AMN1 <119..>187 CDD:187754 15/76 (20%)
leucine-rich repeat 133..158 CDD:275381 8/33 (24%)
leucine-rich repeat 159..183 CDD:275381 5/23 (22%)
leucine-rich repeat 233..258 CDD:275381 1/24 (4%)
leucine-rich repeat 259..282 CDD:275381 8/24 (33%)
AMN1 263..>410 CDD:187754 41/163 (25%)
leucine-rich repeat 283..308 CDD:275381 5/24 (21%)
leucine-rich repeat 309..336 CDD:275381 6/26 (23%)
leucine-rich repeat 337..361 CDD:275381 8/27 (30%)
leucine-rich repeat 362..387 CDD:275381 9/34 (26%)
leucine-rich repeat 388..412 CDD:275381 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.