DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT3G44630

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_850655.1 Gene:AT3G44630 / 823589 AraportID:AT3G44630 Length:1240 Species:Arabidopsis thaliana


Alignment Length:419 Identity:94/419 - (22%)
Similarity:161/419 - (38%) Gaps:122/419 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 EQLMLDDRFLSRF--FQY------FSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQ 337
            |:|.:.::.|.|.  ||:      |:....|:  |:.::  |.:|.|||          .|.|:.
plant   651 EELNISEKALERIHDFQFVKINYVFTHQPERV--QLALE--DLIYHSPR----------IRSLKW 701

  Fly   338 MPGCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHSFPLASKHVHSLSLRCSSISDRGLETLLD 402
            .|      ..|..:...|:...||                      .|.:|||.:  |.|.....
plant   702 FP------YQNICLPSTFNPEFLV----------------------ELDMRCSKL--RKLWEGTK 736

  Fly   403 HLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHV 467
            .|::|..::|:...::.|      |...|..|:....:::.|  ..::.:|.||:...:||...:
plant   737 QLRNLKWMDLSDSRDLKE------LPSSIEKLTSLQILDLRD--CSSLVKLPPSINANNLQGLSL 793

  Fly   468 TDAALGYFSP--KQSHSLSILRLQSC----------------WELTNHGIVNIVHSLP------- 507
            |:.:.....|  :...:|..|:||:|                |:|...|..::| .||       
plant   794 TNCSRVVKLPAIENVTNLHQLKLQNCSSLIELPLSIGTANNLWKLDIRGCSSLV-KLPSSIGDMT 857

  Fly   508 HLTVLSLSGCSKLTDDGVELIAE--NLQKLRALDLSWCPRITDASLEYIACDLN--QLEELTLDR 568
            :|....||.||.|    |||.:.  |||||..|.:..|     :.||.:..::|  .|..|.|..
plant   858 NLKEFDLSNCSNL----VELPSSIGNLQKLFMLRMRGC-----SKLETLPTNINLISLRILDLTD 913

  Fly   569 C----------VHITDI---GVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNL-QVLSLAGC 619
            |          .||:::   |.......||:|:    | |::..:.:.:..|::.. ..|.:...
plant   914 CSQLKSFPEISTHISELRLKGTAIKEVPLSITS----W-SRLAVYEMSYFESLKEFPHALDIITD 973

  Fly   620 PLLTSSGLSS----LIQLRHLQELELTNC 644
            .||.|..:..    :.::..|:.|.|.||
plant   974 LLLVSEDIQEVPPWVKRMSRLRALRLNNC 1002

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/23 (30%)
AMN1 383..600 CDD:187754 63/258 (24%)
leucine-rich repeat 431..456 CDD:275381 4/24 (17%)
leucine-rich repeat 457..482 CDD:275381 4/26 (15%)
leucine-rich repeat 483..508 CDD:275381 11/47 (23%)
leucine-rich repeat 509..534 CDD:275381 11/26 (42%)
leucine-rich repeat 535..560 CDD:275381 6/26 (23%)
leucine-rich repeat 561..585 CDD:275381 7/36 (19%)
leucine-rich repeat 586..610 CDD:275381 4/23 (17%)
leucine-rich repeat 636..661 CDD:275381 5/9 (56%)
AT3G44630NP_850655.1 PLN03210 89..1107 CDD:215633 94/419 (22%)
TIR 94..259 CDD:279864
AAA 283..411 CDD:99707
LRR_3 717..736 CDD:285026 8/42 (19%)
leucine-rich repeat 741..764 CDD:275380 6/28 (21%)
leucine-rich repeat 765..787 CDD:275380 4/23 (17%)
leucine-rich repeat 788..810 CDD:275380 4/21 (19%)
AMN1 809..974 CDD:187754 44/179 (25%)
leucine-rich repeat 811..845 CDD:275380 8/33 (24%)
leucine-rich repeat 859..882 CDD:275380 11/26 (42%)
leucine-rich repeat 883..905 CDD:275380 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.