DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AT3G27290

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_566814.1 Gene:AT3G27290 / 822348 AraportID:AT3G27290 Length:382 Species:Arabidopsis thaliana


Alignment Length:295 Identity:64/295 - (21%)
Similarity:101/295 - (34%) Gaps:97/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 CIKWRDTLYRSPRYW-----SGLLPTLQCRELRQMPGCDRGKLYNSLIRRGFH----ALGLV--- 361
            |:..|.|| .|...|     .||:.  :...|.:.|.|.|.:...:.|...||    .:|:|   
plant    38 CMNIRSTL-NSISDWFHENQIGLVS--EDHTLPEDPFCMRVRSTLNTISDWFHENQKEIGVVDQM 99

  Fly   362 ------------------------GASDEDALDVVHSFPLASKHVHSLSLRCSSISDR-GLETLL 401
                                    |....||.::|..: |..|.:.::.:.|.|:.|. |.|.. 
plant   100 LFETLSWFYNNDDDDGDDDDDGGGGGEAHDAFELVLPY-LELKEILAVEVVCRSLRDSVGKEPF- 162

  Fly   402 DHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYH 466
                                 .|       .|:.|.|                      |...|.
plant   163 ---------------------FW-------TSIDLND----------------------SFLQYR 177

  Fly   467 VTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAEN 531
            |||.:|...:.:....:..|.|..|..:|::|:..::.|.||||.||:|||.:|:..|:.....:
plant   178 VTDESLLKLTRRALGGVRCLNLGGCVGITDYGLKQVLASNPHLTKLSVSGCLRLSTAGLVSTLRD 242

  Fly   532 LQKLRALDLSWCPRITDASLEYIACDLNQLEELTL 566
            |:....|.:.  ..||..:|.:..   .|.:||.|
plant   243 LKSSNRLGVK--SLITGGALYFTK---EQFKELNL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 5/24 (21%)
AMN1 383..600 CDD:187754 41/185 (22%)
leucine-rich repeat 431..456 CDD:275381 3/24 (13%)
leucine-rich repeat 457..482 CDD:275381 6/24 (25%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 10/24 (42%)
leucine-rich repeat 535..560 CDD:275381 4/24 (17%)
leucine-rich repeat 561..585 CDD:275381 3/6 (50%)
leucine-rich repeat 586..610 CDD:275381
leucine-rich repeat 636..661 CDD:275381
AT3G27290NP_566814.1 leucine-rich repeat 164..193 CDD:275381 10/57 (18%)
AMN1 178..>260 CDD:187754 25/83 (30%)
leucine-rich repeat 194..219 CDD:275381 6/24 (25%)
AIR1 <310..>368 CDD:227414
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.