DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and EBF1

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_565597.1 Gene:EBF1 / 817087 AraportID:AT2G25490 Length:628 Species:Arabidopsis thaliana


Alignment Length:341 Identity:90/341 - (26%)
Similarity:148/341 - (43%) Gaps:64/341 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 RGFHALGL-VGASDEDALDVVHSFPLASKHVHSLSLRCSS-----------ISDRGLETLLDHLQ 405
            :||..:|. ||....::|.:.....:....:.|:...|.:           :||.||.:......
plant   323 KGFWVMGNGVGLQKLNSLTITACQGVTDMGLESVGKGCPNMKKAIISKSPLLSDNGLVSFAKASL 387

  Fly   406 SLFELELAGCNEVTEAGLWACLT---PRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHV 467
            ||..|:|..|:.||:.|.:..|.   .::.:.||.:|::|.|...|..|    |.:..:|::..:
plant   388 SLESLQLEECHRVTQFGFFGSLLNCGEKLKAFSLVNCLSIRDLTTGLPA----SSHCSALRSLSI 448

  Fly   468 TD---------AALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDD 523
            .:         ||:|...| |...:.:..|:.   :|..|.::::.|  .|..::.||||.|||.
plant   449 RNCPGFGDANLAAIGKLCP-QLEDIDLCGLKG---ITESGFLHLIQS--SLVKINFSGCSNLTDR 507

  Fly   524 GVELI-AENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLT 587
            .:..| |.|...|..|::..|..||||||..||.:...|.:|.:.:|.                 
plant   508 VISAITARNGWTLEVLNIDGCSNITDASLVSIAANCQILSDLDISKCA----------------- 555

  Fly   588 ALFLRWCSQVRDFGLQHLCS--MRNLQVLSLAGCPLLTSSGLSSLIQL-RHLQELELTNCPGASH 649
                     :.|.|:|.|.|  ...||:||:|||.::|...|.:::.| ..|..|.|..|...|:
plant   556 ---------ISDSGIQALASSDKLKLQILSVAGCSMVTDKSLPAIVGLGSTLLGLNLQQCRSISN 611

  Fly   650 ELFDYLKEHLPRCLII 665
            ...|:|.|.|.:|.|:
plant   612 STVDFLVERLYKCDIL 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 6/34 (18%)
AMN1 383..600 CDD:187754 58/240 (24%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 6/33 (18%)
leucine-rich repeat 483..508 CDD:275381 4/24 (17%)
leucine-rich repeat 509..534 CDD:275381 11/25 (44%)
leucine-rich repeat 535..560 CDD:275381 11/24 (46%)
leucine-rich repeat 561..585 CDD:275381 3/23 (13%)
leucine-rich repeat 586..610 CDD:275381 5/25 (20%)
leucine-rich repeat 636..661 CDD:275381 9/24 (38%)
EBF1NP_565597.1 F-box-like 64..101 CDD:372399
AMN1 <149..298 CDD:187754
leucine-rich repeat 179..204 CDD:275381
leucine-rich repeat 205..230 CDD:275381
leucine-rich repeat 231..256 CDD:275381
leucine-rich repeat 257..283 CDD:275381
leucine-rich repeat 284..308 CDD:275381
leucine-rich repeat 309..336 CDD:275381 5/12 (42%)
leucine-rich repeat 337..362 CDD:275381 3/24 (13%)
leucine-rich repeat 363..388 CDD:275381 4/24 (17%)
leucine-rich repeat 416..442 CDD:275381 8/29 (28%)
AMN1 440..611 CDD:187754 54/202 (27%)
leucine-rich repeat 443..468 CDD:275381 5/25 (20%)
leucine-rich repeat 469..492 CDD:275381 4/27 (15%)
leucine-rich repeat 493..519 CDD:275381 11/25 (44%)
leucine-rich repeat 520..545 CDD:275381 11/24 (46%)
leucine-rich repeat 546..571 CDD:275381 8/50 (16%)
leucine-rich repeat 572..591 CDD:275381 9/18 (50%)
leucine-rich repeat 598..619 CDD:275381 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.