DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and MEE11

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_565268.1 Gene:MEE11 / 814691 AraportID:AT2G01620 Length:292 Species:Arabidopsis thaliana


Alignment Length:175 Identity:52/175 - (29%)
Similarity:78/175 - (44%) Gaps:29/175 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 LLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADE-AVGAVAQLLPSLYEFSLQ 463
            :|.:|.|||||                |:...||.||.|.|.  || |:.....:.|.|      
plant    23 VLPYLHSLFEL----------------LSMIRVSRSLRDAIR--DETALWTKLVIEPPL------ 63

  Fly   464 AYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDG---- 524
            :..:||..|..||.|.:..|..|.|:.|..:||.|:..:|.:.|.:|.:.:.|||.||.:|    
plant    64 SSRLTDDILSEFSSKSAGKLKTLILRQCLMVTNKGLRRVVDANPLITKIIVPGCSGLTPEGIMEC 128

  Fly   525 VELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRC 569
            ||.:::|..||..|.::.....|...|..:...|:....:.|:.|
plant   129 VESLSKNNHKLETLHINGVNGFTKQHLSALYTYLSSEGTIDLEVC 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 2/5 (40%)
AMN1 383..600 CDD:187754 52/175 (30%)
leucine-rich repeat 431..456 CDD:275381 9/25 (36%)
leucine-rich repeat 457..482 CDD:275381 7/24 (29%)
leucine-rich repeat 483..508 CDD:275381 8/24 (33%)
leucine-rich repeat 509..534 CDD:275381 10/28 (36%)
leucine-rich repeat 535..560 CDD:275381 5/24 (21%)
leucine-rich repeat 561..585 CDD:275381 2/9 (22%)
leucine-rich repeat 586..610 CDD:275381
leucine-rich repeat 636..661 CDD:275381
MEE11NP_565268.1 leucine-rich repeat 83..108 CDD:275381 8/24 (33%)
leucine-rich repeat 109..138 CDD:275381 10/28 (36%)
leucine-rich repeat 139..164 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.