DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and Fbxl22

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_780415.1 Gene:Fbxl22 / 74165 MGIID:1921415 Length:236 Species:Mus musculus


Alignment Length:198 Identity:51/198 - (25%)
Similarity:86/198 - (43%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 SLSLRCSSI----SDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIAD 444
            |||..||.:    .|..|..|| |..||.||:.....          |:|.:.|||:  |.:.:.
Mouse    25 SLSRTCSQLRDVFEDPTLWPLL-HFHSLAELKKDNFR----------LSPALRSLSI--CWHSSR 76

  Fly   445 EAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHL 509
            ..|.::...|.|..:.|:.:.|.:                         |.|..::.:.:..|:|
Mouse    77 VQVCSIEDWLKSALQRSICSQHES-------------------------LVNDFLLQVCNRCPNL 116

  Fly   510 TVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITD 574
            |.::||||..:|||.:..:..:..:||.|.|..|.|:|:.:|..:|.....|:.|.:|.|.:::.
Mouse   117 TSVTLSGCGHVTDDCLARLLLSCPRLRTLRLENCARVTNRTLAAVAAHGRALQTLHVDFCRNVSA 181

  Fly   575 IGV 577
            .|:
Mouse   182 AGL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 10/25 (40%)
AMN1 383..600 CDD:187754 51/198 (26%)
leucine-rich repeat 431..456 CDD:275381 6/24 (25%)
leucine-rich repeat 457..482 CDD:275381 2/24 (8%)
leucine-rich repeat 483..508 CDD:275381 2/24 (8%)
leucine-rich repeat 509..534 CDD:275381 9/24 (38%)
leucine-rich repeat 535..560 CDD:275381 9/24 (38%)
leucine-rich repeat 561..585 CDD:275381 5/17 (29%)
leucine-rich repeat 586..610 CDD:275381
leucine-rich repeat 636..661 CDD:275381
Fbxl22NP_780415.1 F-box-like 3..43 CDD:403981 6/17 (35%)
LRR 1 15..40 5/14 (36%)
LRR 2 43..72 12/41 (29%)
AMN1 45..>200 CDD:187754 44/178 (25%)
LRR 3 98..123 7/49 (14%)
leucine-rich repeat 116..141 CDD:275381 9/24 (38%)
LRR 4 124..149 8/24 (33%)
leucine-rich repeat 142..167 CDD:275381 9/24 (38%)
LRR 5 150..175 7/24 (29%)
leucine-rich repeat 168..193 CDD:275381 5/17 (29%)
LRR 6 176..201 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.