Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_780415.1 | Gene: | Fbxl22 / 74165 | MGIID: | 1921415 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 51/198 - (25%) |
---|---|---|---|
Similarity: | 86/198 - (43%) | Gaps: | 42/198 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 384 SLSLRCSSI----SDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIAD 444
Fly 445 EAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHL 509
Fly 510 TVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITD 574
Fly 575 IGV 577 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | 10/25 (40%) |
AMN1 | 383..600 | CDD:187754 | 51/198 (26%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 2/24 (8%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 2/24 (8%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 5/17 (29%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | |||
leucine-rich repeat | 636..661 | CDD:275381 | |||
Fbxl22 | NP_780415.1 | F-box-like | 3..43 | CDD:403981 | 6/17 (35%) |
LRR 1 | 15..40 | 5/14 (36%) | |||
LRR 2 | 43..72 | 12/41 (29%) | |||
AMN1 | 45..>200 | CDD:187754 | 44/178 (25%) | ||
LRR 3 | 98..123 | 7/49 (14%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 9/24 (38%) | ||
LRR 4 | 124..149 | 8/24 (33%) | |||
leucine-rich repeat | 142..167 | CDD:275381 | 9/24 (38%) | ||
LRR 5 | 150..175 | 7/24 (29%) | |||
leucine-rich repeat | 168..193 | CDD:275381 | 5/17 (29%) | ||
LRR 6 | 176..201 | 2/9 (22%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |