DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and fbxl5

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_012816107.1 Gene:fbxl5 / 496483 XenbaseID:XB-GENE-968565 Length:662 Species:Xenopus tropicalis


Alignment Length:468 Identity:109/468 - (23%)
Similarity:168/468 - (35%) Gaps:132/468 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PPIHSIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCR------ 333
            ||     ::||:      .|.|.:|.:....:||..||.. |.|:...|..|.|.|..|      
 Frog   209 PP-----EVMLN------IFSYLNPQDLCRCSQVNTKWAQ-LARTGSLWRHLYPVLWARGDWYSG 261

  Fly   334 ---ELRQMPG-------CDRGKLYNSLIRRGFHALGLVGASDEDA-LD----------------- 370
               .|...|.       .|..:.|...              |||| :|                 
 Frog   262 PPTHLDNEPDEDWISRRKDESRAYQEW--------------DEDADIDESEETGEDDPSISVAQR 312

  Fly   371 -------VVH-SFPLASKHVHSLSLRCSS-ISDRGLETLLDHLQSLFELELAGCNEVTEAGL--W 424
                   :|| ..|.....|.:|.|..|| .|::.:..:|::..::..|:|.. .:::::..  |
 Frog   313 EKELLNSLVHYILPYIGHSVKTLVLAYSSATSNKVIRQILEYCPNMEHLDLTQ-TDISDSAFNGW 376

  Fly   425 ---ACLTPRIVSLSLADCINIADEAVG--AVAQLLPSLYEFS-LQAYH----VTD---------- 469
               ||.|.|.:.||  .|..|.|.|:.  :||..:|..::.. |:.|.    |.|          
 Frog   377 CFGACQTLRHIDLS--GCEKITDSALEKLSVALGMPLAHKKRLLKCYRNNRTVKDIRNQMRCGSL 439

  Fly   470 ----AALGYFSPKQSHSLSILRLQSC--------WELTNHGIVNIVHSLPHLTVLSLSGCSKLTD 522
                ...|.:|...|..:.||...:.        |:......:.::...|:||..| :||.....
 Frog   440 AQITGESGIYSDYSSSQIWILNSGNLGDIEDAADWKFRTTDGLGVLEMTPNLTCFS-NGCCSRAV 503

  Fly   523 DGVELIAENLQKLRALDLSWCPR-ITDASLEYI-ACDLNQLEELTLDRCVHITDIGVGYISTMLS 585
            .|........:..:|..|::|.. :...:|..| |...:.:...||..  .|.||..|  |..|.
 Frog   504 PGRWTNVIRQEHCKAAPLNYCGHTLCGNTLRTIQALPGSNIGTKTLQS--EIRDICPG--SAKLD 564

  Fly   586 ------LTALFLRWCSQVRDFGLQHLC---SMRNLQVLSLAGCPLLTSSGLSSLIQLRHLQELEL 641
                  |..|.|..|.|:.|.||:.|.   .:.||:.|:|:||..:|.|||..|:          
 Frog   565 QQVARVLQFLSLSGCHQITDHGLRVLTIGGGLPNLEHLNLSGCLNVTGSGLQDLV---------- 619

  Fly   642 TNCPGASHELFDY 654
            :.||..:.|.|.|
 Frog   620 SACPSLNDEHFYY 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/24 (29%)
AMN1 383..600 CDD:187754 58/259 (22%)
leucine-rich repeat 431..456 CDD:275381 8/26 (31%)
leucine-rich repeat 457..482 CDD:275381 7/43 (16%)
leucine-rich repeat 483..508 CDD:275381 3/32 (9%)
leucine-rich repeat 509..534 CDD:275381 6/24 (25%)
leucine-rich repeat 535..560 CDD:275381 6/26 (23%)
leucine-rich repeat 561..585 CDD:275381 7/23 (30%)
leucine-rich repeat 586..610 CDD:275381 9/26 (35%)
leucine-rich repeat 636..661 CDD:275381 5/19 (26%)
fbxl5XP_012816107.1 Hr_FBXL5 7..160 CDD:213984
F-box-like 205..249 CDD:372399 14/51 (27%)
leucine-rich repeat 332..357 CDD:275381 7/24 (29%)
AMN1 <340..444 CDD:187754 24/106 (23%)
leucine-rich repeat 358..383 CDD:275381 5/25 (20%)
leucine-rich repeat 384..438 CDD:275381 14/55 (25%)
leucine-rich repeat 439..500 CDD:275381 12/61 (20%)
leucine-rich repeat 511..559 CDD:275381 11/49 (22%)
AMN1 556..>625 CDD:187754 26/80 (33%)
leucine-rich repeat 571..598 CDD:275381 9/26 (35%)
leucine-rich repeat 599..624 CDD:275381 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.