Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001252264.2 | Gene: | gadr-5 / 4927064 | WormBaseID: | WBGene00045058 | Length: | 915 | Species: | Caenorhabditis elegans |
Alignment Length: | 211 | Identity: | 44/211 - (20%) |
---|---|---|---|
Similarity: | 86/211 - (40%) | Gaps: | 57/211 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 445 EAVGAVAQLL-PSLYEFSLQAYHVTDA--------ALGYFSPKQSHSLSILRLQSCWELTNHGIV 500
Fly 501 NIVH--SLPHLTVLSLSGC-SKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLE 562
Fly 563 ELTL-DRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSG 626
Fly 627 LSSLIQLRHLQELELT 642 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | |
AMN1 | 383..600 | CDD:187754 | 32/167 (19%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 4/11 (36%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 5/32 (16%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 3/26 (12%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 9/25 (36%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 636..661 | CDD:275381 | 2/7 (29%) | ||
gadr-5 | NP_001252264.2 | MFS | <15..201 | CDD:119392 | |
LRR | <311..514 | CDD:227223 | 33/146 (23%) | ||
leucine-rich repeat | 348..372 | CDD:275382 | 5/24 (21%) | ||
LRR_4 | 371..>402 | CDD:289563 | 12/59 (20%) | ||
leucine-rich repeat | 373..396 | CDD:275382 | 8/51 (16%) | ||
leucine-rich repeat | 397..419 | CDD:275380 | 6/21 (29%) | ||
leucine-rich repeat | 420..449 | CDD:275380 | 2/7 (29%) | ||
leucine-rich repeat | 450..473 | CDD:275380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162700 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |