DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and gadr-5

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001252264.2 Gene:gadr-5 / 4927064 WormBaseID:WBGene00045058 Length:915 Species:Caenorhabditis elegans


Alignment Length:211 Identity:44/211 - (20%)
Similarity:86/211 - (40%) Gaps:57/211 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 EAVGAVAQLL-PSLYEFSLQAYHVTDA--------ALGYFSPKQSHSLSILRLQSCWELTNHGIV 500
            ||:.:...|| |..|:|..:|..:.::        |..|:    :.::.|:.          .:.
 Worm   260 EAIFSKLLLLNPKAYKFIAKATQIQESVVIGKRVHAQHYY----ARNIDIMT----------SLT 310

  Fly   501 NIVH--SLPHLTVLSLSGC-SKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLE 562
            ::::  ||..:..|.:..| |:||...|.||...|..|::||:|..| ::......:......|:
 Worm   311 SVLYGKSLAKIHSLDIGECRSQLTPGWVRLIGTMLPSLQSLDISNKP-LSKEDFSQLCNFFQNLQ 374

  Fly   563 ELTL-DRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSG 626
            :|.: |.||.                             .||.:..::||:|||:......|::.
 Worm   375 KLNISDTCVK-----------------------------KLQGISKLKNLKVLSMRNLQFRTATD 410

  Fly   627 LSSLIQLRHLQELELT 642
            :..|.:|:.|..|:::
 Worm   411 MLDLFKLKGLVALDVS 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381
AMN1 383..600 CDD:187754 32/167 (19%)
leucine-rich repeat 431..456 CDD:275381 4/11 (36%)
leucine-rich repeat 457..482 CDD:275381 5/32 (16%)
leucine-rich repeat 483..508 CDD:275381 3/26 (12%)
leucine-rich repeat 509..534 CDD:275381 9/25 (36%)
leucine-rich repeat 535..560 CDD:275381 5/24 (21%)
leucine-rich repeat 561..585 CDD:275381 5/24 (21%)
leucine-rich repeat 586..610 CDD:275381 2/23 (9%)
leucine-rich repeat 636..661 CDD:275381 2/7 (29%)
gadr-5NP_001252264.2 MFS <15..201 CDD:119392
LRR <311..514 CDD:227223 33/146 (23%)
leucine-rich repeat 348..372 CDD:275382 5/24 (21%)
LRR_4 371..>402 CDD:289563 12/59 (20%)
leucine-rich repeat 373..396 CDD:275382 8/51 (16%)
leucine-rich repeat 397..419 CDD:275380 6/21 (29%)
leucine-rich repeat 420..449 CDD:275380 2/7 (29%)
leucine-rich repeat 450..473 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162700
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.