DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and CG14891

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:449 Identity:93/449 - (20%)
Similarity:155/449 - (34%) Gaps:126/449 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 HPPPIH-----SIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQC 332
            ||.|:.     |...|.:.|....:...|.|..||...|..|.:::                   
  Fly    99 HPTPVEESGTLSAYDLPITDDIWWKVLDYLSLNERLNFAASCERFQ------------------- 144

  Fly   333 RELRQMPGCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHS-----FPLASKHVHSLSLRCSSI 392
                        .:|.....|..|.|.:     :|...:.|.     ..|:.||:|     |  :
  Fly   145 ------------AIYELDSHRINHVLNM-----KDVCTLTHRVIKRLMLLSGKHIH-----C--V 185

  Fly   393 SDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSL 457
            :...|.....:|....:|....|..:||...:.      :|:|||...::.|.|.|.:     ::
  Fly   186 TGGPLHPNWPYLTEFVQLLGVSCPNLTELSFFK------ISVSLAHMTHLFDGANGLI-----NI 239

  Fly   458 YEFSLQAYHVTDAALGY----------------FSPKQSH------SLSILRLQSCWELTNHGIV 500
            ...||:..::.||.: |                ||.|...      ||.||.:..|.:|:...::
  Fly   240 TNISLRRCNLKDAHI-YCLQMLSKLKSLDIRENFSIKGDSLKSLPISLEILNVSGCVDLSPKCLI 303

  Fly   501 NIVHSLPHLTVLSLSGCSKLTDDGVEL------------IAENLQKLRALDLSWCPRI------T 547
            .:. :|.||..|...|..|...|. ||            :.|....:..:.|....|:      :
  Fly   304 QLA-ALSHLRELRCPGIVKFAKDN-ELYGRLAHYCPMLEVLELTDFMNVIQLGGLSRLHTLVIHS 366

  Fly   548 DASLEY---------IA--CDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFG 601
            .|.|:|         ||  ..|..||.|.....:..|...:...|.:..|..|.|    ..::|.
  Fly   367 SAQLDYHVNNVLLTSIAESYSLRHLEILDSFGPMSDTSFDLSIFSQLKELRTLIL----HNQNFT 427

  Fly   602 LQHLCSMR---NLQVLSLAGCPLLTSSGLSSLIQ-LRHLQELELTNCPGASHELFDYLK 656
            ..||..::   .|:.|.|:|.|.|::..::.|.: |..|:.|::..||..:.:|...|:
  Fly   428 TLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRLKVDFCPLITRQLTKILE 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 4/23 (17%)
AMN1 383..600 CDD:187754 55/267 (21%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 8/46 (17%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 8/36 (22%)
leucine-rich repeat 535..560 CDD:275381 8/41 (20%)
leucine-rich repeat 561..585 CDD:275381 5/23 (22%)
leucine-rich repeat 586..610 CDD:275381 6/26 (23%)
leucine-rich repeat 636..661 CDD:275381 6/21 (29%)
CG14891NP_650560.1 RRM_6 25..91 CDD:290958
AMN1 <199..352 CDD:187754 35/166 (21%)
leucine-rich repeat 211..237 CDD:275381 9/31 (29%)
leucine-rich repeat 239..262 CDD:275381 5/23 (22%)
leucine-rich repeat 263..285 CDD:275381 3/21 (14%)
leucine-rich repeat 286..338 CDD:275381 14/53 (26%)
leucine-rich repeat 339..387 CDD:275381 8/47 (17%)
leucine-rich repeat 388..415 CDD:275381 6/26 (23%)
leucine-rich repeat 416..439 CDD:275381 6/26 (23%)
leucine-rich repeat 440..465 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457967
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.