DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and CG12402

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster


Alignment Length:719 Identity:141/719 - (19%)
Similarity:238/719 - (33%) Gaps:250/719 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GNSNSNSGSNSS-----------------------NSNTSSASATAATSPASNANPPQTP----- 112
            |||...||..|.                       |.|...|.|.:..:|.:   ||.||     
  Fly     2 GNSLITSGKPSQRREKRLFERLSCSYAQTPNRMELNLNPLLAIARSIAAPPT---PPPTPEKLDS 63

  Fly   113 DKPSRGSSPSPGGITMPG-----------------------------------GQSQVQNSTHHL 142
            ||...|||.:...: :|.                                   .:.:|..:.|:|
  Fly    64 DKDKEGSSKAAIEL-LPNEMWLEIMSYLSYNDLLQLRMVSWRCRDLVHRRRFMEKGKVIVTQHNL 127

  Fly   143 -----------------------LQQQQQQQQHMQLQQSQQQHLQLQ------------------ 166
                                   |:|.:|.:..::|...:.:|||::                  
  Fly   128 EAIHKHAKGGNCYLSFERIELRNLRQCRQLENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNLKVL 192

  Fly   167 --ASTLINSNHHVMVGPAPPTGMPLGAPPTPTVKSIAKQMNITIPGGGVNPGSPTFSTMGMVAAQ 229
              |:|:...:.|            |.|.....:|..:..:.....|..::    ....|.|:   
  Fly   193 TIATTMSMDDQH------------LAAMDDLDMKQFSHLVGFECDGVSLD----AVLKMRML--- 238

  Fly   230 KAAASAGGTPLQLRK---QLPNPHLHHPYGSMGINAASPLIMQHQLHPPPIHSIEQLMLDDRFLS 291
                      ||||:   ::...||...:.....||...::..|         .|.|:..:.|.|
  Fly   239 ----------LQLRRTENKVQLRHLQFEFRRNNENALLDVLQDH---------AETLVCVNLFFS 284

  Fly   292 RFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGK--------LYN 348
                             |....||     |.|        ||....|......|        |..
  Fly   285 -----------------CSPGIDT-----REW--------CRAFENMHNLRTLKLSGNCHLVLLE 319

  Fly   349 SLIR--------RGFHALGLVGASDEDALDVVHSFPLASKHVHSLS----LRCSSISDRGLETLL 401
            :::|        |.....|::..::|..|.|      |.|...:|.    :.|..::...::.|.
  Fly   320 AVLRAVPESAPIRQLDLTGMLSLTNELLLYV------AGKWQSTLKVLDLMFCVQLNANCIDALR 378

  Fly   402 DHLQSLFELELAGCNEVTEAGLWACLTPRI----VSLSLADCINIADEAVGAVAQLLPSLYEFSL 462
            .....|..|.:|.|.|:|..||...|...|    ..|.|.:.|.:.:.::..:.:.||:|...||
  Fly   379 QLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSL 443

  Fly   463 ----QAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNI------VHSLPHLTVLSLSGC 517
                ||  |||..:......|:. |..|.::.|.::|:.|::..      :..|..|..|:|.||
  Fly   444 DNCRQA--VTDRTMATICQYQTR-LRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGC 505

  Fly   518 SKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYIST 582
            ..:||..: ::...|.:||||.|.:|.|:|....|.:..:...||.|.:..|:.:.|      .|
  Fly   506 RNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDD------ET 563

  Fly   583 MLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRH-LQELELTNCPG 646
            :|::.:                  :::.|:||:|:.|..||...:..::...| |.:|...:..|
  Fly   564 VLNIVS------------------NLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDG 610

  Fly   647 ASHE 650
            ..||
  Fly   611 MDHE 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 3/27 (11%)
AMN1 383..600 CDD:187754 57/234 (24%)
leucine-rich repeat 431..456 CDD:275381 5/28 (18%)
leucine-rich repeat 457..482 CDD:275381 9/28 (32%)
leucine-rich repeat 483..508 CDD:275381 6/30 (20%)
leucine-rich repeat 509..534 CDD:275381 8/24 (33%)
leucine-rich repeat 535..560 CDD:275381 9/24 (38%)
leucine-rich repeat 561..585 CDD:275381 6/23 (26%)
leucine-rich repeat 586..610 CDD:275381 0/23 (0%)
leucine-rich repeat 636..661 CDD:275381 5/15 (33%)
CG12402NP_001303481.1 F-box 75..117 CDD:279040 1/42 (2%)
leucine-rich repeat 281..303 CDD:275381 10/51 (20%)
LRR_RI <297..482 CDD:238064 43/193 (22%)
leucine-rich repeat 304..330 CDD:275381 3/25 (12%)
leucine-rich repeat 331..357 CDD:275381 7/31 (23%)
leucine-rich repeat 358..379 CDD:275381 3/20 (15%)
leucine-rich repeat 384..409 CDD:275381 9/24 (38%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 48/192 (25%)
leucine-rich repeat 438..464 CDD:275381 9/27 (33%)
leucine-rich repeat 465..496 CDD:275381 6/30 (20%)
leucine-rich repeat 497..521 CDD:275381 8/24 (33%)
leucine-rich repeat 522..547 CDD:275381 9/24 (38%)
leucine-rich repeat 548..573 CDD:275381 7/48 (15%)
leucine-rich repeat 574..599 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.