DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32085 and fbxl15

DIOPT Version :9

Sequence 1:	NP_729732.1	Gene:	CG32085 / 39311	FlyBaseID:	FBgn0052085	Length:	666	Species:	Drosophila melanogaster
Sequence 2:	NP_998107.1	Gene:	fbxl15 / 405878	ZFINID:	ZDB-GENE-040426-2440	Length:	296	Species:	Danio rerio

Alignment Length:	203	Identity:	49/203 - (24%)
Similarity:	90/203 - (44%)	Gaps:	33/203 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   383 HSLSLRCSS-ISDRGLETLLDHLQSLFELELAGCNEVTEAGLWA----CLTPRIVSLSLADCINI 442
            |.....||. |:|..|..::...|.|..::|.||.:::...|.|    |  ||:..||||.|..:
Zfish    88 HLSVTNCSDWITDTDLLPVIGQNQQLQHVDLRGCAQLSRRALVAVSLSC--PRLQHLSLAHCEWV 150

  Fly   443 ADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLP 507
            ...|:.::|...|.|....|.|                          |.:|.:..:..:....|
Zfish   151 DSLALRSLADHCPMLRSLDLTA--------------------------CRQLKDPAVCYLAGKCP 189

  Fly   508 HLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHI 572
            .|..||::..:.:||..||.:|:..:::..|||:.|.|:.:.::..:|....:|:.|.::.|.::
Zfish   190 ELRALSVAVNANITDTAVEEVAKKCREMERLDLTGCLRVRNEAIRTLAEYCPKLQSLKVNHCHNV 254

  Fly   573 TDIGVGYI 580
            |:..:|.:
Zfish   255 TESSLGVL 262

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32085	NP_729732.1	leucine-rich repeat	382..406	CDD:275381	6/23 (26%)
		AMN1	383..600	CDD:187754	49/203 (24%)
		leucine-rich repeat	431..456	CDD:275381	7/24 (29%)
		leucine-rich repeat	457..482	CDD:275381	3/24 (13%)
		leucine-rich repeat	483..508	CDD:275381	2/24 (8%)
		leucine-rich repeat	509..534	CDD:275381	8/24 (33%)
		leucine-rich repeat	535..560	CDD:275381	6/24 (25%)
		leucine-rich repeat	561..585	CDD:275381	5/20 (25%)
		leucine-rich repeat	586..610	CDD:275381
		leucine-rich repeat	636..661	CDD:275381
fbxl15	NP_998107.1	F-box	16..>52	CDD:279040
		leucine-rich repeat	51..85	CDD:275381
		leucine-rich repeat	86..112	CDD:275381	6/23 (26%)
		AMN1	<111..272	CDD:187754	43/180 (24%)
		leucine-rich repeat	113..138	CDD:275381	7/26 (27%)
		LRR 1	138..159		7/20 (35%)
		leucine-rich repeat	139..164	CDD:275381	7/24 (29%)
		LRR 2	164..185		5/46 (11%)
		leucine-rich repeat	165..190	CDD:275381	5/50 (10%)
		LRR 3	190..211		7/20 (35%)
		leucine-rich repeat	191..216	CDD:275381	8/24 (33%)
		LRR 4	216..237		5/20 (25%)
		leucine-rich repeat	217..242	CDD:275381	6/24 (25%)
		LRR 5	242..263		5/21 (24%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1947
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900