DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and CG9003

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001097271.1 Gene:CG9003 / 36244 FlyBaseID:FBgn0033639 Length:651 Species:Drosophila melanogaster


Alignment Length:757 Identity:170/757 - (22%)
Similarity:268/757 - (35%) Gaps:237/757 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSISAQGVVERASAELSKRINGLGLRSKHHHSSTSSGAGGAGDAASPAGATPTPAAPSGKTSVME 66
            :|.:..||:|......:    |.|..|.::...:||.:||||      |:......|||.:|:  
  Fly     3 ASSAETGVMEVGGTSGT----GTGSSSSNNGGGSSSNSGGAG------GSIELLCPPSGSSSI-- 55

  Fly    67 RVTNALCGGGNSNSNSGSNSSNSNTSSASATAATSPASNANPPQTPDKPSRGSSPSPGGITMPGG 131
                  .|..:.:||||::.|:|.|.|.:.::||..::|......|.....|:          ||
  Fly    56 ------SGSASFSSNSGASGSSSQTHSTAVSSATDRSNNNGNNHNPSLQLNGN----------GG 104

  Fly   132 QSQVQ-----NSTHHLLQQQQQQQQHMQLQQSQQQHLQLQASTLINSNHHVMV------------ 179
            .:..|     ||..|..........::....|....   ..|...|:||...:            
  Fly   105 SNTRQHSSGSNSRQHSSSSSNSNSSNISPPPSSSSS---SRSNNNNNNHSSNIISGFCSTIWRSA 166

  Fly   180 --GPAPPTGMPLGAPPTPTVKSIAKQMNITIPGGGVNP------------GSPTFSTMGMVAAQK 230
              |.|.|...||                   |...:||            .|.|...:|:...|:
  Fly   167 TFGSATPVINPL-------------------PAVSINPKIMESSSDSCSLSSSTTPDVGLADQQR 212

  Fly   231 AAASA-------------GGTPL--QLRKQLPNPHLHHPYGSMGINAASPLIMQHQLHPPPIHSI 280
            ..|.:             |.|.|  :|.||||.                                
  Fly   213 NMAGSAQDQSEDQSQTFLGATELDDELIKQLPK-------------------------------- 245

  Fly   281 EQLMLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSGLL---PTLQCRELRQMPGCD 342
                   ..|.|.|.|.........||||           :||:.|.   .:.|...|.......
  Fly   246 -------EVLLRVFSYLDVVSLCRCAQVC-----------KYWNVLALDGSSWQKINLFDFQRDI 292

  Fly   343 RGKLYNSLIR--RGFHALGLVGASDEDALDVVHSFPLASKHVHSLSLR-CSSISDRGLETLLDHL 404
            .|.:..::.:  |||                          :.||||| |.|:.|:.:.||.:|.
  Fly   293 EGPVIENISQRCRGF--------------------------LKSLSLRGCQSVGDQSVRTLANHC 331

  Fly   405 QSLFELELAGCNEVTEAGLWA----CLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAY 465
            .::..|:|:.|.::|:....:    |  .::.:::|..|.||.|.::..::...|:|.|.::...
  Fly   332 HNIEHLDLSDCKKITDISTQSISRYC--SKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWC 394

  Fly   466 HVTD-----------AALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSK 519
            |:..           ..|..||.|           .|.::.::.|:.:....|.|.||:|..|..
  Fly   395 HLISENGVEALARGCVKLRKFSSK-----------GCKQINDNAIMCLAKYCPDLMVLNLHSCET 448

  Fly   520 LTDDGVELIAENLQKLRALDLSWCPRITDA-------------SLEYIAC-------------DL 558
            :||..:..:|.|..||:.|.:|.|..:||.             :||...|             :.
  Fly   449 ITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGRNC 513

  Fly   559 NQLEELTLDRCVHITDIGVGYIST-MLSLTALFLRWCSQVRDFGLQHL----CSMRNLQVLSLAG 618
            ..||.:.|:.|..|||:.:.:::| ..||..|.|..|..:.|.|::||    |:...|.||.|..
  Fly   514 KYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDN 578

  Fly   619 CPLLTSSGLSSLIQLRHLQELELTNCPGASHELFDYLKEHLP 660
            |||:|...|..|:...:||.:||.:|...:......||.|||
  Fly   579 CPLITDRTLEHLVSCHNLQRIELFDCQLITRTAIRKLKNHLP 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 11/24 (46%)
AMN1 383..600 CDD:187754 64/259 (25%)
leucine-rich repeat 431..456 CDD:275381 5/24 (21%)
leucine-rich repeat 457..482 CDD:275381 7/35 (20%)
leucine-rich repeat 483..508 CDD:275381 2/24 (8%)
leucine-rich repeat 509..534 CDD:275381 9/24 (38%)
leucine-rich repeat 535..560 CDD:275381 9/50 (18%)
leucine-rich repeat 561..585 CDD:275381 8/24 (33%)
leucine-rich repeat 586..610 CDD:275381 9/27 (33%)
leucine-rich repeat 636..661 CDD:275381 10/25 (40%)
CG9003NP_001097271.1 F-box-like 240..285 CDD:289689 16/94 (17%)
leucine-rich repeat 280..307 CDD:275381 4/26 (15%)
AMN1 <308..453 CDD:187754 39/157 (25%)
leucine-rich repeat 308..327 CDD:275381 8/18 (44%)
leucine-rich repeat 334..359 CDD:275381 5/26 (19%)
leucine-rich repeat 360..385 CDD:275381 5/24 (21%)
leucine-rich repeat 386..411 CDD:275381 3/24 (13%)
AMN1 <409..586 CDD:187754 52/187 (28%)
leucine-rich repeat 412..437 CDD:275381 6/35 (17%)
leucine-rich repeat 438..463 CDD:275381 9/24 (38%)
leucine-rich repeat 464..515 CDD:275381 9/50 (18%)
leucine-rich repeat 516..541 CDD:275381 8/24 (33%)
leucine-rich repeat 542..561 CDD:275381 6/18 (33%)
leucine-rich repeat 571..595 CDD:275381 10/23 (43%)
leucine-rich repeat 596..621 CDD:275381 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I1756
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47209
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.