DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and CG15056

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:398 Identity:96/398 - (24%)
Similarity:154/398 - (38%) Gaps:121/398 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   355 FHALGLVGASDEDALDVVHSFPLASK-------------HVHSLSLRCSSISDRGLETLLDH--L 404
            |.:..::...|...|||:....|.|:             :|.|..||.|.:.:  ||.:::.  |
  Fly     3 FISFSVISRFDFFWLDVLKQLDLKSRISFAASCDMFENIYVRSSPLRLSRVVN--LEEMIEFSLL 65

  Fly   405 QSLFELELAGCN-EVTEAGLWACLTP---------RIVSLSLADCINIADEAVGAVAQLLPSLYE 459
            ::...:||:|.: |:...|..   ||         |::|:.|.....||.|.             
  Fly    66 ETKLFVELSGSDIEIIRGGPH---TPMFSHFEDFIRLMSIRLTKVNEIALEG------------- 114

  Fly   460 FSLQAYHVTDAALGYFSPKQSHS-LSILRLQSC---------WELTNH-------------GIVN 501
            |.|..|...:|      |:.|.| |:.:.|:.|         ||...|             |  :
  Fly   115 FQLTQYKWFNA------PETSFSNLTYVSLRRCQLNDENLVGWEFLTHLETLDLRYNDRLTG--S 171

  Fly   502 IVHSLP-HLTVLSLSGCSKLTDDGVELIAEN----LQKLRALDL----SW---------CP---- 544
            .:.||| .|..|.::||..|..:  :||..|    |::|||.||    .|         ||    
  Fly   172 CLMSLPTSLLSLYITGCRNLCPN--QLIFLNRIPRLRELRASDLMPGGHWHIYRDLVLACPLLVM 234

  Fly   545 -RITDASL---EYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTAL---FLR---WCSQVRD 599
             .|:..||   ||...:|..|:.|.:.  .|.||.....:|..:.::.|   |||   :......
  Fly   235 VEISICSLNRDEYRLGELRYLQSLVIK--AHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSG 297

  Fly   600 F----GLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRH---LQELELTNCPGASHELFDYLKE 657
            |    .|..:...|.|:||.:...|...    :.|::||:   |:.|:|:|.|..::|:...|..
  Fly   298 FVSANALSIISRFRQLRVLKMPNQPYRP----NDLLRLRNLTFLETLDLSNSPYITNEVVIELVI 358

  Fly   658 HLPRCLII 665
            .:|...::
  Fly   359 GIPNLSVL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 8/25 (32%)
AMN1 383..600 CDD:187754 70/283 (25%)
leucine-rich repeat 431..456 CDD:275381 5/24 (21%)
leucine-rich repeat 457..482 CDD:275381 6/24 (25%)
leucine-rich repeat 483..508 CDD:275381 10/47 (21%)
leucine-rich repeat 509..534 CDD:275381 9/28 (32%)
leucine-rich repeat 535..560 CDD:275381 14/45 (31%)
leucine-rich repeat 561..585 CDD:275381 6/23 (26%)
leucine-rich repeat 586..610 CDD:275381 6/33 (18%)
leucine-rich repeat 636..661 CDD:275381 7/24 (29%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/22 (23%)
leucine-rich repeat 157..179 CDD:275381 4/23 (17%)
leucine-rich repeat 180..204 CDD:275381 8/25 (32%)
leucine-rich repeat 205..231 CDD:275381 8/25 (32%)
leucine-rich repeat 232..285 CDD:275381 13/54 (24%)
leucine-rich repeat 286..326 CDD:275381 9/43 (21%)
AMN1 306..>376 CDD:187754 16/65 (25%)
leucine-rich repeat 337..362 CDD:275381 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457966
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.