Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101073.1 | Gene: | Fbxl15 / 309453 | RGDID: | 1306444 | Length: | 300 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 69/260 - (26%) |
---|---|---|---|
Similarity: | 107/260 - (41%) | Gaps: | 36/260 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 310 IKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLYNSLIRRGFHA---LGLVGASDEDALDV 371
Fly 372 VHSFPLA--------SKHVHSLSLR-CSS-ISDRGLETLLDHLQSLFELELAGCNEVTEAGLWA- 425
Fly 426 ---CLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQA-YHVTDAALGYFSPKQSHSLSIL 486
Fly 487 RLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASL 551
Fly 552 551 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | 6/25 (24%) |
AMN1 | 383..600 | CDD:187754 | 50/176 (28%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 10/24 (42%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 6/17 (35%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | |||
leucine-rich repeat | 586..610 | CDD:275381 | |||
leucine-rich repeat | 636..661 | CDD:275381 | |||
Fbxl15 | NP_001101073.1 | F-box | 18..55 | CDD:395521 | 12/48 (25%) |
leucine-rich repeat | 62..88 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 89..115 | CDD:275381 | 6/25 (24%) | ||
Interaction with SMURF1. /evidence=ECO:0000250 | 113..269 | 44/153 (29%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 8/26 (31%) | ||
AMN1 | <139..>268 | CDD:187754 | 37/127 (29%) | ||
leucine-rich repeat | 142..167 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 168..194 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 195..220 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 221..245 | CDD:275381 | 10/23 (43%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |