Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001008334.2 | Gene: | Amn1 / 302032 | RGDID: | 1308119 | Length: | 258 | Species: | Rattus norvegicus |
Alignment Length: | 266 | Identity: | 72/266 - (27%) |
---|---|---|---|
Similarity: | 113/266 - (42%) | Gaps: | 78/266 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 426 CLTPRIVSLS--LADC----INIADEAVGAVAQ------------LLPSLYEFSLQAYHVTDAAL 472
Fly 473 GYFSPKQSHSLSILRLQSCWE----LTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQ 533
Fly 534 KLRALDLSWCPRITDASLE-------YIAC-DLN-------------------QLEELTLDRCVH 571
Fly 572 ITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSG---LSSLIQL 633
Fly 634 RHLQEL 639 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | |
AMN1 | 383..600 | CDD:187754 | 60/222 (27%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 7/42 (17%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 10/28 (36%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 11/24 (46%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 11/51 (22%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | 6/23 (26%) | ||
leucine-rich repeat | 636..661 | CDD:275381 | 1/4 (25%) | ||
Amn1 | NP_001008334.2 | leucine-rich repeat | 10..35 | CDD:275381 | 5/20 (25%) |
leucine-rich repeat | 36..58 | CDD:275381 | 2/21 (10%) | ||
AMN1 | 37..257 | CDD:187754 | 65/243 (27%) | ||
leucine-rich repeat | 63..86 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 87..116 | CDD:275381 | 10/28 (36%) | ||
leucine-rich repeat | 117..142 | CDD:275381 | 11/24 (46%) | ||
leucine-rich repeat | 143..168 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 169..195 | CDD:275381 | 2/25 (8%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 11/34 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |