DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and FBXL22

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_011519770.1 Gene:FBXL22 / 283807 HGNCID:27537 Length:260 Species:Homo sapiens


Alignment Length:71 Identity:25/71 - (35%)
Similarity:42/71 - (59%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 PHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVH 571
            |:|..::||||..:|||.:..:.....:||||.|..|.|:|:.:|..:|.|...|:.|.:|.|.:
Human   149 PNLASVTLSGCGHVTDDCLARLLRCCPRLRALRLENCARVTNRTLAAVAADGRALQTLHVDFCRN 213

  Fly   572 ITDIGV 577
            ::..|:
Human   214 VSAAGL 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381
AMN1 383..600 CDD:187754 25/71 (35%)
leucine-rich repeat 431..456 CDD:275381
leucine-rich repeat 457..482 CDD:275381