DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and Fbxl4

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_766576.1 Gene:Fbxl4 / 269514 MGIID:2140367 Length:621 Species:Mus musculus


Alignment Length:299 Identity:71/299 - (23%)
Similarity:112/299 - (37%) Gaps:82/299 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 LSLRCSS-ISDRGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVG 448
            |.|.||. ::|..||.:.:                        :.|.:..|:|:.|..:..:|.|
Mouse   380 LELSCSHFLNDTCLEVISE------------------------MCPNLQDLNLSSCDKLPPQAFG 420

  Fly   449 AVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLS 513
            .:|:|. ||....|....|...||          ||||..  |.||.:               ||
Mouse   421 HIAKLC-SLKRLVLYRTKVEQTAL----------LSILNF--CAELQH---------------LS 457

  Fly   514 LSGCSKLTDDGV--ELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIG 576
            |..|..:.|..|  .:|....:.||.|||..|..||:          |.:.||. ..||.:.::.
Mouse   458 LGSCVMIEDYDVIASMIGAKCKNLRTLDLWRCKNITE----------NGIAELA-SGCVLLEELD 511

  Fly   577 VGYISTMLSLTALFLRWCSQ--------------VRDFGLQHLCS-MRNLQVLSLAGCPLLTSSG 626
            :|:..|:.|.|..|:|...|              |.|..::.|.| ...||.|.:.|..:::.:.
Mouse   512 LGWCPTLQSSTGCFVRLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVSPAS 576

  Fly   627 LSSLIQ-LRHLQELELTNCPGASHELFDYLKEHLPRCLI 664
            |..|:: .:.|..|:::.|....::....|....|:..|
Mouse   577 LRKLLESCKDLSLLDVSFCSQIDNKAVLELNASFPKVFI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/21 (33%)
AMN1 383..600 CDD:187754 56/231 (24%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 5/24 (21%)
leucine-rich repeat 483..508 CDD:275381 7/24 (29%)
leucine-rich repeat 509..534 CDD:275381 7/26 (27%)
leucine-rich repeat 535..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..585 CDD:275381 6/23 (26%)
leucine-rich repeat 586..610 CDD:275381 8/38 (21%)
leucine-rich repeat 636..661 CDD:275381 4/24 (17%)
Fbxl4NP_766576.1 F-box-like 280..318 CDD:372399
leucine-rich repeat 295..317 CDD:275381
leucine-rich repeat 318..340 CDD:275381
leucine-rich repeat 347..376 CDD:275381
LRR 1 376..397 7/16 (44%)
leucine-rich repeat 377..402 CDD:275381 7/45 (16%)
AMN1 394..601 CDD:187754 62/269 (23%)
LRR 2 402..421 4/18 (22%)
leucine-rich repeat 403..427 CDD:275381 7/24 (29%)
LRR 3 427..448 9/30 (30%)
leucine-rich repeat 428..452 CDD:275381 10/35 (29%)
LRR 4 452..474 8/36 (22%)
leucine-rich repeat 453..480 CDD:275381 8/41 (20%)
LRR 5 480..501 10/30 (33%)
leucine-rich repeat 481..506 CDD:275381 12/35 (34%)
LRR 6 504..524 6/19 (32%)
leucine-rich repeat 507..534 CDD:275381 7/26 (27%)
LRR 7 532..558 4/25 (16%)
leucine-rich repeat 535..560 CDD:275381 4/24 (17%)
LRR 8 559..583 6/23 (26%)
leucine-rich repeat 561..586 CDD:275381 6/24 (25%)
LRR 9 584..609 4/24 (17%)
leucine-rich repeat 587..612 CDD:275381 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.