DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and FBXL3

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_036290.1 Gene:FBXL3 / 26224 HGNCID:13599 Length:428 Species:Homo sapiens


Alignment Length:402 Identity:74/402 - (18%)
Similarity:139/402 - (34%) Gaps:148/402 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 MLDDRFLSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYW-----------SGLLPTLQCRELRQ 337
            :|.|..| :.|:|....:|...:|||..| :.::..|..|           :..|.......::|
Human    39 LLQDIIL-QVFKYLPLLDRAHASQVCRNW-NQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQ 101

  Fly   338 M-----------------------PGCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHSFPLA- 378
            :                       ..||   :.:.|:......|||:..:....:|:..|..:: 
Human   102 IIKRHSNHLQYVSFKVDSSKESAEAACD---ILSQLVNCSLKTLGLISTARPSFMDLPKSHFISA 163

  Fly   379 -------SKHVHSLSLRCSSISDRGLETLL-DHLQSLFELELAGCNEVTEAGLWACLTPRIVSLS 435
                   ||.:.||.:..:.:.|..|:.|: ::..:|..|:::.|..|:.||:            
Human   164 LTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGI------------ 216

  Fly   436 LADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRL------------ 488
                :.:||:..|        |.|.:|..:.::|..|...|.::...|..||:            
Human   217 ----LCVADQCHG--------LRELALNYHLLSDELLLALSSEKHVRLEHLRIDVVSENPGQTHF 269

  Fly   489 ----QSCWE--LTNHGIVNIV---------------HSLP--HL--------TVLSLSGCSKLTD 522
                :|.|:  :.:...||:|               :.:|  ||        .||...|.:    
Human   270 HTIQKSSWDAFIRHSPKVNLVMYFFLYEEEFDPFFRYEIPATHLYFGRSVSKDVLGRVGMT---- 330

  Fly   523 DGVELIAENLQKLRALDLSWCPRITDASLEYIAC--DLNQLEELTL---DRCVHITDIGVGYIST 582
                                |||:    :|.:.|  .|..|:|..:   :||.:::.||:|....
Human   331 --------------------CPRL----VELVVCANGLRPLDEELIRIAERCKNLSAIGLGECEV 371

  Fly   583 MLSLTALFLRWC 594
            ..|....|::.|
Human   372 SCSAFVEFVKMC 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 5/24 (21%)
AMN1 383..600 CDD:187754 50/261 (19%)
leucine-rich repeat 431..456 CDD:275381 3/24 (13%)
leucine-rich repeat 457..482 CDD:275381 6/24 (25%)
leucine-rich repeat 483..508 CDD:275381 9/59 (15%)
leucine-rich repeat 509..534 CDD:275381 4/32 (13%)
leucine-rich repeat 535..560 CDD:275381 6/26 (23%)
leucine-rich repeat 561..585 CDD:275381 7/26 (27%)
leucine-rich repeat 586..610 CDD:275381 2/9 (22%)
leucine-rich repeat 636..661 CDD:275381
FBXL3NP_036290.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
F-box-like 36..77 CDD:403981 11/39 (28%)
LRR 1 119..146 6/29 (21%)
leucine-rich repeat 174..199 CDD:275381 5/24 (21%)
LRR 2 181..207 5/25 (20%)
leucine-rich repeat 200..225 CDD:275381 8/40 (20%)
LRR 3 208..233 10/48 (21%)
LRR 4 234..259 6/24 (25%)
leucine-rich repeat 252..286 CDD:275381 5/33 (15%)
leucine-rich repeat 287..333 CDD:275381 10/69 (14%)
LRR 5 316..341 7/52 (13%)
leucine-rich repeat 334..360 CDD:275381 7/29 (24%)
LRR 6 343..368 7/24 (29%)
leucine-rich repeat 361..383 CDD:275381 5/21 (24%)
LRR 7 369..394 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.