DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and pof2

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_596079.1 Gene:pof2 / 2540355 PomBaseID:SPBC25B2.11 Length:463 Species:Schizosaccharomyces pombe


Alignment Length:414 Identity:92/414 - (22%)
Similarity:158/414 - (38%) Gaps:128/414 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 YFSPYERRILAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLYNSLIRRGFHALGL 360
            |....|.|..:.||..||:.          ::|||..:.:.|    :..:|.|.     |..|  
pombe    14 YLEADELRCKSTVCTSWRNF----------IIPTLWEKVVFQ----NEAQLNNF-----FDTL-- 57

  Fly   361 VGASDEDALDVVHSFPLASKHVHSLSLRCSSI----SDRGLETLLDHLQSLFELELAGCNEVTEA 421
                 :.:.||.:.|....|      |.||.:    :|:.| .|:.....:..|.|:||..::| 
pombe    58 -----QYSKDVSYYFRYLRK------LNCSRVRKFLTDKHL-MLMTLATGISRLNLSGCTRISE- 109

  Fly   422 GLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSIL 486
                   |.|..| |...:|:.......:..|..::.|:      ::|         ...:|..|
pombe   110 -------PLIGKL-LYQNLNLVTINFSNIFSLPANILEY------ISD---------NCPNLKAL 151

  Fly   487 RLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAE--------------------- 530
            .:.:|..:.:.|:|.|:...|:|..|.:..|.||||..:::::|                     
pombe   152 NIGNCGLVEDTGMVQIIKRCPYLNRLIIPNCRKLTDVSLQILSEKEDLIELDISGCEGFHNADTL 216

  Fly   531 --------------------------------NLQKLRALDLSWCPRITDASLEYIACDLNQLEE 563
                                            .|..:|||.|:..|.:.|:.:|.|.|..::|..
pombe   217 SRLVSRNRGLKELSMDGCTELSHFITFLNLNCELDAMRALSLNNLPDLKDSDIELITCKFSKLNS 281

  Fly   564 LTLDRCVHITDIGVGYISTML-------SLTALFLRWCSQVRDFGLQHLC-SMRNLQVLSLAGCP 620
            |.|.:|:.:||      |::|       |||.|.|..|.::.|.|:|.|. |.:|:..:...||.
pombe   282 LFLSKCIGLTD------SSLLSLTKLSQSLTTLHLGHCYEITDIGVQCLLKSCKNITYIDFGGCL 340

  Fly   621 LLTSSGLSSLIQLRHLQELELTNC 644
            .|:...:|::.:|.:||.:.|..|
pombe   341 RLSDIAVSAIAKLPYLQRVGLVKC 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 6/27 (22%)
AMN1 383..600 CDD:187754 58/280 (21%)
leucine-rich repeat 431..456 CDD:275381 5/24 (21%)
leucine-rich repeat 457..482 CDD:275381 2/24 (8%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 9/77 (12%)
leucine-rich repeat 535..560 CDD:275381 9/24 (38%)
leucine-rich repeat 561..585 CDD:275381 8/30 (27%)
leucine-rich repeat 586..610 CDD:275381 10/24 (42%)
leucine-rich repeat 636..661 CDD:275381 4/9 (44%)
pof2NP_596079.1 F-box-like 2..45 CDD:289689 10/40 (25%)
leucine-rich repeat 96..121 CDD:275381 9/33 (27%)
leucine-rich repeat 122..141 CDD:275381 2/24 (8%)
AMN1 <143..292 CDD:187754 30/157 (19%)
leucine-rich repeat 148..173 CDD:275381 6/24 (25%)
leucine-rich repeat 174..225 CDD:275381 8/50 (16%)
leucine-rich repeat 226..278 CDD:275381 10/51 (20%)
AMN1 <278..428 CDD:187754 29/93 (31%)
leucine-rich repeat 279..304 CDD:275381 8/30 (27%)
leucine-rich repeat 305..330 CDD:275381 10/24 (42%)
leucine-rich repeat 331..355 CDD:275381 5/23 (22%)
leucine-rich repeat 356..382 CDD:275381 4/9 (44%)
leucine-rich repeat 383..408 CDD:275381
leucine-rich repeat 409..427 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47209
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.