DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and AMN1

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001106873.1 Gene:AMN1 / 196394 HGNCID:27281 Length:258 Species:Homo sapiens


Alignment Length:340 Identity:73/340 - (21%)
Similarity:132/340 - (38%) Gaps:102/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 PYERRI--LAQVCIKWRDTLYRSPRYWSGLLPTLQCRELRQMPGCDRGKLYNSLIRRGFHALGLV 361
            |..||:  |..:|: | ..:....||.:.:.|         :|...:.:|...:..:|       
Human     2 PRPRRVSQLLDLCL-W-CFMKNISRYLTDIKP---------LPPNIKDRLIKIMSMQG------- 48

  Fly   362 GASDEDALDVVHSFPLASKHVHSLSLRCSSISDRGLETLLDHLQSLFELELAGCNEVTEAGLWAC 426
            ..:|.:..:::|      ..|.:|.||...|||..|            |.|:.|.::.:..|   
Human    49 QITDSNISEILH------PEVQTLDLRSCDISDAAL------------LHLSNCRKLKKLNL--- 92

  Fly   427 LTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSC 491
                  :.|..:.:::..|.:.|||.....|:|.|                          |:.|
Human    93 ------NASKGNRVSVTSEGIKAVASSCSYLHEAS--------------------------LKRC 125

  Fly   492 WELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIA- 555
            ..||:.|:|.:..:...|.::.|.||..:||..:..:.:|...|:.:|.| ..:::|:.:..:. 
Human   126 CNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFS-ATQVSDSGVIALVS 189

  Fly   556 --CDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGLQHLCSMRNLQVLSLAG 618
              | ..:|||:.:..||::||   |.:..:|:       :|.|:|              :|...|
Human   190 GPC-AKKLEEIHMGHCVNLTD---GAVEAVLT-------YCPQIR--------------ILLFHG 229

  Fly   619 CPLLTSSGLSSLIQL 633
            |||:|......|.||
Human   230 CPLITDHSREVLEQL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 8/23 (35%)
AMN1 383..600 CDD:187754 49/219 (22%)
leucine-rich repeat 431..456 CDD:275381 5/24 (21%)
leucine-rich repeat 457..482 CDD:275381 3/24 (13%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 7/24 (29%)
leucine-rich repeat 535..560 CDD:275381 5/27 (19%)
leucine-rich repeat 561..585 CDD:275381 8/23 (35%)
leucine-rich repeat 586..610 CDD:275381 3/23 (13%)
leucine-rich repeat 636..661 CDD:275381
AMN1NP_001106873.1 AMN1 37..257 CDD:187754 63/294 (21%)
leucine-rich repeat 63..86 CDD:275381 11/34 (32%)
leucine-rich repeat 87..116 CDD:275381 6/37 (16%)
leucine-rich repeat 117..142 CDD:275381 9/50 (18%)
leucine-rich repeat 143..168 CDD:275381 7/24 (29%)
leucine-rich repeat 169..195 CDD:275381 5/27 (19%)
leucine-rich repeat 196..221 CDD:275381 10/34 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.