DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and Y9C9A.13

DIOPT Version :10

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_001359968.1 Gene:Y9C9A.13 / 189418 WormBaseID:WBGene00021180 Length:635 Species:Caenorhabditis elegans


Alignment Length:290 Identity:63/290 - (21%)
Similarity:108/290 - (37%) Gaps:97/290 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 DVVHSFPLASKH--VHSLSLRCSSISDRGLETLLDH-LQSL----------FELELAGCNEVTEA 421
            :||..||..||:  :..::|:...::...::.|.:| |:||          ::.::|..:|:.:.
 Worm    49 EVVKFFPKISKNFFLTKVNLKNVRLTHPMIKLLSEHTLESLALGDQAIRKDYKNDIAQVDEILQI 113

  Fly   422 GLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSL--S 484
            .|.......:..|.::......:.|:..:.:|||     |||:..|.|.   .||......|  |
 Worm   114 ILNKKSANNLRQLDISGSRRFLNGAIKKIGKLLP-----SLQSLIVCDR---LFSGSDFQKLCSS 170

  Fly   485 ILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAE------------NLQKLRA 537
            ...|:|. ::::.|            |.||.|.|:||:  :|.:|.            .|.||.|
 Worm   171 FKNLKSL-DISDTG------------VSSLYGISQLTN--LETLAMRNLNICEFGHIFRLSKLEA 220

  Fly   538 LDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFGL 602
            ||||:                                       |......:.:|..|:.|.|  
 Worm   221 LDLSF---------------------------------------TKFDRIPVIMRQYSESRGF-- 244

  Fly   603 QHLCSMRNLQVLSLAGCPLLTSSGLSSLIQ 632
                 :.||:.|..:|.. :|.|.|..|:|
 Worm   245 -----IPNLKFLDCSGTD-VTFSILDELLQ 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 F-box_FBXL16 283..325 CDD:438899
leucine-rich repeat 382..406 CDD:275381 4/24 (17%)
AMN1 383..600 CDD:187754 47/241 (20%)
leucine-rich repeat 431..456 CDD:275381 4/24 (17%)
leucine-rich repeat 457..482 CDD:275381 7/24 (29%)
leucine-rich repeat 483..508 CDD:275381 5/26 (19%)
leucine-rich repeat 509..534 CDD:275381 10/36 (28%)
leucine-rich repeat 535..560 CDD:275381 6/24 (25%)
leucine-rich repeat 561..585 CDD:275381 1/23 (4%)
leucine-rich repeat 586..610 CDD:275381 4/23 (17%)
leucine-rich repeat 636..661 CDD:275381
Y9C9A.13NP_001359968.1 LRR <122..328 CDD:443914 48/217 (22%)
leucine-rich repeat 123..148 CDD:275381 5/29 (17%)
leucine-rich repeat 149..173 CDD:275381 8/26 (31%)
leucine-rich repeat 174..195 CDD:275381 9/33 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.