Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001362175.1 | Gene: | K05C4.9 / 187021 | WormBaseID: | WBGene00010585 | Length: | 718 | Species: | Caenorhabditis elegans |
Alignment Length: | 218 | Identity: | 48/218 - (22%) |
---|---|---|---|
Similarity: | 81/218 - (37%) | Gaps: | 75/218 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 496 NHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQK----------------------LRAL 538
Fly 539 DLSWCPRITDAS--LEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVRDFG 601
Fly 602 LQHLCSMRNLQVLSLAGCPL-----------LTSSGLSSLIQ-LRHLQELE----LTNCPGASHE 650
Fly 651 LFDYLKEH--------LPRCLII 665 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | |
AMN1 | 383..600 | CDD:187754 | 28/127 (22%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | |||
leucine-rich repeat | 457..482 | CDD:275381 | |||
leucine-rich repeat | 483..508 | CDD:275381 | 2/11 (18%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 6/26 (23%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | 0/23 (0%) | ||
leucine-rich repeat | 636..661 | CDD:275381 | 6/36 (17%) | ||
K05C4.9 | NP_001362175.1 | leucine-rich repeat | 126..151 | CDD:275381 | |
leucine-rich repeat | 152..176 | CDD:275381 | 2/11 (18%) | ||
leucine-rich repeat | 177..198 | CDD:275378 | 6/21 (29%) | ||
leucine-rich repeat | 199..223 | CDD:275378 | 2/23 (9%) | ||
leucine-rich repeat | 224..253 | CDD:275378 | 8/29 (28%) | ||
leucine-rich repeat | 254..278 | CDD:275378 | 7/45 (16%) | ||
leucine-rich repeat | 279..290 | CDD:275378 | 4/10 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162711 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |