DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and F44E5.2

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_496512.2 Gene:F44E5.2 / 185735 WormBaseID:WBGene00009689 Length:489 Species:Caenorhabditis elegans


Alignment Length:296 Identity:61/296 - (20%)
Similarity:121/296 - (40%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   387 LRCSSISDRGLETLLDHLQ-----SLFELELAGCNEV--------TEAGLWACL-TPRIVSLSLA 437
            :.|.|:||..:..:..::|     |.|..|::  |::        .|.....|| ..|.::::.|
 Worm     1 MACKSLSDISVGQVAKNIQHRDYDSCFNPEIS--NQIFTKLVALDIELDPNYCLQISRKLNITKA 63

  Fly   438 DCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNI 502
            .|.|:..|.:    :||.:....||...::......|...|::..::|.||          :.::
 Worm    64 VCKNVTTEHI----KLLSNNCILSLTIGNIDKVKQVYQDDKENPIINIARL----------LEDV 114

  Fly   503 V--HSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELT 565
            :  .|..:|..|.:.|....:.:..:.:...|..|:.|.:  |.|      .:|..:.:||    
 Worm   115 LGEESRQNLQYLDIQGNELFSYNWPKALGHMLPSLQTLIV--CQR------SFINDEFSQL---- 167

  Fly   566 LDRC--------VHITDIGVGYISTMLSLTALFLRWCSQVRDF----GLQHLCSMRNLQVLSLAG 618
               |        :.|:|..:|.:|.:.:|..| .:.|....:|    .::.|..:::|:||:::.
 Worm   168 ---CNSFPNLHKLDISDTNIGNLSGISNLKNL-QKLCMMNLEFESYDDIKELFEVKSLRVLNISR 228

  Fly   619 -----CPLLTSSGLSSLIQLRH-LQELELTNCPGAS 648
                 .|.|    :...|||:. |.||...:|.|.:
 Worm   229 DRKDFKPSL----IMQYIQLKEVLPELRFLDCSGTN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 5/23 (22%)
AMN1 383..600 CDD:187754 46/236 (19%)
leucine-rich repeat 431..456 CDD:275381 6/24 (25%)
leucine-rich repeat 457..482 CDD:275381 4/24 (17%)
leucine-rich repeat 483..508 CDD:275381 4/26 (15%)
leucine-rich repeat 509..534 CDD:275381 4/24 (17%)
leucine-rich repeat 535..560 CDD:275381 5/24 (21%)
leucine-rich repeat 561..585 CDD:275381 6/31 (19%)
leucine-rich repeat 586..610 CDD:275381 5/27 (19%)
leucine-rich repeat 636..661 CDD:275381 5/13 (38%)
F44E5.2NP_496512.2 leucine-rich repeat 123..148 CDD:275380 4/24 (17%)
leucine-rich repeat 149..173 CDD:275380 8/38 (21%)
LRR_4 172..215 CDD:289563 8/43 (19%)
leucine-rich repeat 174..195 CDD:275380 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162707
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.