DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and B0564.9

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_502528.2 Gene:B0564.9 / 178266 WormBaseID:WBGene00007208 Length:423 Species:Caenorhabditis elegans


Alignment Length:401 Identity:90/401 - (22%)
Similarity:145/401 - (36%) Gaps:148/401 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 SIEQLMLDDRFLSRFFQYFSPYERRILAQVCIKWR-DTLYRSPRYWSGLLPTLQCRELR--QMPG 340
            |||::.:.:..:.                 |.:|. .|:.|  :.:..||.  :||:||  ::.|
 Worm   130 SIEEISITNSMIE-----------------CSEWDVATIIR--KSFGTLLK--KCRKLRYFEISG 173

  Fly   341 CDRGKLYNSLIRRGFHA----LGLVGASDED-ALDVVHSFPLAS------KHVHSLSLRCSSISD 394
                   ..|:...||.    |..:..:.|. |:.|.||..:.|      |.:.:|:|:.|.||.
 Worm   174 -------QCLMNSHFHVDPKILQFISNTVEHLAIAVGHSLTINSLAFLKDKRLKTLNLQRSFISP 231

  Fly   395 RGLETLLDHLQSLFELELAGCNEVTEAGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYE 459
            ..||.::....::..|:|:.                  |::|.||..||:               
 Worm   232 CDLEHIVAMADTITHLDLSR------------------SVNLLDCRQIAE--------------- 263

  Fly   460 FSLQAYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSK-LTDD 523
                                                   :||:.|       |||....: :.||
 Worm   264 ---------------------------------------LVNLRH-------LSLKNNKEGVRDD 282

  Fly   524 GVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTA 588
            .::||.:|..||..|.|..|..:|..||..:. :||.|::|:|...|::.|.....||....||.
 Worm   283 SLQLIIKNCSKLEELSLDCCEYLTVNSLITLG-NLNNLKQLSLPGIVNVDDSVCLQISRCSKLTY 346

  Fly   589 LFLRWCSQVRDFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRHLQELELTNCPGASHELFD 653
            |.:.:|.:|:..||  ||         |..|  |||           |..||:......||.|. 
 Worm   347 LNINFCRRVQKRGL--LC---------LLSC--LTS-----------LDHLEVLGIRAYSHHLL- 386

  Fly   654 YLKEHLPRCLI 664
            .|..:.|:.::
 Worm   387 ALHINFPKTIV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/23 (30%)
AMN1 383..600 CDD:187754 48/217 (22%)
leucine-rich repeat 431..456 CDD:275381 6/24 (25%)
leucine-rich repeat 457..482 CDD:275381 0/24 (0%)
leucine-rich repeat 483..508 CDD:275381 3/24 (13%)
leucine-rich repeat 509..534 CDD:275381 8/25 (32%)
leucine-rich repeat 535..560 CDD:275381 8/24 (33%)
leucine-rich repeat 561..585 CDD:275381 7/23 (30%)
leucine-rich repeat 586..610 CDD:275381 9/23 (39%)
leucine-rich repeat 636..661 CDD:275381 7/24 (29%)
B0564.9NP_502528.2 leucine-rich repeat 106..130 CDD:275381 90/401 (22%)
leucine-rich repeat 131..159 CDD:275381 6/46 (13%)
leucine-rich repeat 166..193 CDD:275381 7/33 (21%)
leucine-rich repeat 195..214 CDD:275381 6/18 (33%)
leucine-rich repeat 219..243 CDD:275381 7/23 (30%)
leucine-rich repeat 244..266 CDD:275381 8/93 (9%)
leucine-rich repeat 267..293 CDD:275381 9/32 (28%)
leucine-rich repeat 294..318 CDD:275381 8/24 (33%)
leucine-rich repeat 319..343 CDD:275381 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.