Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741137.1 | Gene: | skpt-1 / 175749 | WormBaseID: | WBGene00018613 | Length: | 421 | Species: | Caenorhabditis elegans |
Alignment Length: | 242 | Identity: | 63/242 - (26%) |
---|---|---|---|
Similarity: | 97/242 - (40%) | Gaps: | 48/242 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 418 VTEAGLWACLTPRIVSLSL----ADCINIADEAVGAVAQLLPSLYE-FSLQAYHVTDAALGYFSP 477
Fly 478 KQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKLTDDGVELIAENLQKLRALDLSW 542
Fly 543 C----PRIT-------------------------DASLEYIACDLNQLEELTLDRCVHITDIGVG 578
Fly 579 YI-STMLSLTALFLRWCSQVRDFGLQ-----HLCSMRNLQVLSLAGC 619 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | |
AMN1 | 383..600 | CDD:187754 | 55/216 (25%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 12/28 (43%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 9/53 (17%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | 8/28 (29%) | ||
leucine-rich repeat | 636..661 | CDD:275381 | |||
skpt-1 | NP_741137.1 | F-box-like | 92..130 | CDD:372399 | |
AMN1 | 150..373 | CDD:187754 | 58/230 (25%) | ||
leucine-rich repeat | 153..183 | CDD:275381 | 12/29 (41%) | ||
leucine-rich repeat | 184..208 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 209..232 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 233..258 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 259..284 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 285..313 | CDD:275381 | 2/27 (7%) | ||
leucine-rich repeat | 314..339 | CDD:275381 | 7/24 (29%) | ||
leucine-rich repeat | 340..362 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 365..388 | CDD:275381 | 4/9 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162699 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |