DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and B0393.3

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_497980.1 Gene:B0393.3 / 175630 WormBaseID:WBGene00007168 Length:621 Species:Caenorhabditis elegans


Alignment Length:433 Identity:92/433 - (21%)
Similarity:153/433 - (35%) Gaps:122/433 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LPNPHLHHPYGSMGINAASPLIMQHQLHPPPIHSIEQLMLDDRFL--SRFFQY----------FS 298
            |||...|     .|.|           .|.|.|...|.:.||.|:  |...|.          ..
 Worm     2 LPNSFAH-----FGHN-----------FPQPSHFSLQDLRDDEFVQNSALLQLKDSILDIIVEHV 50

  Fly   299 PYERRI--LAQVCIKWRDTLYRSPRYWSGLLPTLQCRELR-QMPGCDRGKLYNSLIRRGFHALGL 360
            |.:.|:  |..||.:..|::.||.:         ....|| ::..||..|:              
 Worm    51 PLKDRLLKLRPVCHRLSDSVKRSVK---------SVEFLRDELDYCDDAKI-------------- 92

  Fly   361 VGASDEDALDVVHSFPLA--SKHVHSLS---LRCSSISDRGLETLLDHLQSLFELELAGCNEVTE 420
                         ||.||  .|:|..::   .|..|:.:   .|.....||:.. .:..|.::.:
 Worm    93 -------------SFFLAVYGKNVQHMNYDLFRSCSLRE---YTQWSWRQSVIS-SVTRCPQLKQ 140

  Fly   421 AGLWACLTPRIVSLSLADCINIADEAVGAVAQLLPSLYEFSLQAYHVTDAALGYFSPKQSHSLSI 485
            ..:..|...|           :.|..:..:.:....|.|..:.|.::.    |:...|...:|..
 Worm   141 LDILICCRHR-----------LRDGDLQVIFKQCNQLEELRMDASYIN----GHCFSKAPQTLRK 190

  Fly   486 LRLQSCWELTNHGIVNIVHSLPHLTVL--SLSGC------SKLTD----DGVELIAENLQKLRAL 538
            |.|:.|..|...|.:.:...|..|..|  ||..|      .::.|    ..:.::|:..||:...
 Worm   191 LELECCQTLNKQGFIGMCSRLFKLQTLHVSLMQCIDEQLIKRIGDMKSLKNLSVVADPDQKMNQF 255

  Fly   539 DLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTM------LSLTALFLRWCSQV 597
            .|:...|            |::|..|.||...::||..:|.:|.:      .|:..|.|.:|..:
 Worm   256 RLAEIRR------------LSKLTTLCLDGVNNVTDKFLGDLSDLSTSPAGSSIEHLSLSFCKNI 308

  Fly   598 RDFGLQHLCSMRNLQVLSLAGCPLL-TSSGLSSLIQLRHLQEL 639
            ...|:..|.::.||:.|:|.|.... .|:||.::.|...|:.|
 Worm   309 GSNGISKLKTLPNLKSLNLDGVSKRDISTGLEAIGQAGRLERL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 4/26 (15%)
AMN1 383..600 CDD:187754 45/237 (19%)
leucine-rich repeat 431..456 CDD:275381 1/24 (4%)
leucine-rich repeat 457..482 CDD:275381 5/24 (21%)
leucine-rich repeat 483..508 CDD:275381 7/24 (29%)
leucine-rich repeat 509..534 CDD:275381 7/36 (19%)
leucine-rich repeat 535..560 CDD:275381 3/24 (13%)
leucine-rich repeat 561..585 CDD:275381 8/29 (28%)
leucine-rich repeat 586..610 CDD:275381 5/23 (22%)
leucine-rich repeat 636..661 CDD:275381 2/4 (50%)
B0393.3NP_497980.1 leucine-rich repeat 103..137 CDD:275381 7/37 (19%)
leucine-rich repeat 138..165 CDD:275381 3/37 (8%)
leucine-rich repeat 188..213 CDD:275381 7/24 (29%)
leucine-rich repeat 214..265 CDD:275381 12/62 (19%)
LRR 232..>389 CDD:227223 32/132 (24%)
AMN1 <262..408 CDD:187754 27/102 (26%)
leucine-rich repeat 266..296 CDD:275381 8/29 (28%)
leucine-rich repeat 297..321 CDD:275381 5/23 (22%)
leucine-rich repeat 348..373 CDD:275381 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.