DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and gadr-6

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_493455.1 Gene:gadr-6 / 173273 WormBaseID:WBGene00009823 Length:710 Species:Caenorhabditis elegans


Alignment Length:233 Identity:47/233 - (20%)
Similarity:77/233 - (33%) Gaps:94/233 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   446 AVGAVAQLL------PSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRL---------------- 488
            |..|:|:|:      ...|.|..::.:...|.|....|:.|:::. |:|                
 Worm     9 AAAAIAKLIHNGHFNSKSYAFDQESSNEVYAQLLRLDPQWSYNID-LKLKGLSFILTKVNFENVE 72

  Fly   489 ---QSCWELTNHGIVNIV-------HSLPH----------LTVLSLSGCSKLTDDGVELIAENLQ 533
               |:...||.|.:.::|       .||.|          :..|.|||.|:.:...::...:.|.
 Worm    73 MGPQTFGLLTQHNLKSLVLGNQDEIPSLEHYMSRLFRTSQIDHLDLSGRSQFSTAWLKTTGQQLP 137

  Fly   534 KLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVR 598
            .||.|::|                                  ||..      |...|.::|.   
 Worm   138 LLRTLNVS----------------------------------GVKL------LNPDFFQFCK--- 159

  Fly   599 DFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRHL 636
                    |..||..|.::.|.:...:|:|.|..||||
 Worm   160 --------SFPNLYSLDISNCGVTILTGISRLKNLRHL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381
AMN1 383..600 CDD:187754 35/195 (18%)
leucine-rich repeat 431..456 CDD:275381 4/15 (27%)
leucine-rich repeat 457..482 CDD:275381 6/24 (25%)
leucine-rich repeat 483..508 CDD:275381 9/50 (18%)
leucine-rich repeat 509..534 CDD:275381 6/24 (25%)
leucine-rich repeat 535..560 CDD:275381 4/24 (17%)
leucine-rich repeat 561..585 CDD:275381 2/23 (9%)
leucine-rich repeat 586..610 CDD:275381 4/23 (17%)
leucine-rich repeat 636..661 CDD:275381 1/1 (100%)
gadr-6NP_493455.1 leucine-rich repeat 86..112 CDD:275381 4/25 (16%)
leucine-rich repeat 113..138 CDD:275381 6/24 (25%)
leucine-rich repeat 139..163 CDD:275381 10/74 (14%)
leucine-rich repeat 164..185 CDD:275381 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162713
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.