Sequence 1: | NP_729732.1 | Gene: | CG32085 / 39311 | FlyBaseID: | FBgn0052085 | Length: | 666 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_493455.1 | Gene: | gadr-6 / 173273 | WormBaseID: | WBGene00009823 | Length: | 710 | Species: | Caenorhabditis elegans |
Alignment Length: | 233 | Identity: | 47/233 - (20%) |
---|---|---|---|
Similarity: | 77/233 - (33%) | Gaps: | 94/233 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 446 AVGAVAQLL------PSLYEFSLQAYHVTDAALGYFSPKQSHSLSILRL---------------- 488
Fly 489 ---QSCWELTNHGIVNIV-------HSLPH----------LTVLSLSGCSKLTDDGVELIAENLQ 533
Fly 534 KLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVGYISTMLSLTALFLRWCSQVR 598
Fly 599 DFGLQHLCSMRNLQVLSLAGCPLLTSSGLSSLIQLRHL 636 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32085 | NP_729732.1 | leucine-rich repeat | 382..406 | CDD:275381 | |
AMN1 | 383..600 | CDD:187754 | 35/195 (18%) | ||
leucine-rich repeat | 431..456 | CDD:275381 | 4/15 (27%) | ||
leucine-rich repeat | 457..482 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 483..508 | CDD:275381 | 9/50 (18%) | ||
leucine-rich repeat | 509..534 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 535..560 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 561..585 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 586..610 | CDD:275381 | 4/23 (17%) | ||
leucine-rich repeat | 636..661 | CDD:275381 | 1/1 (100%) | ||
gadr-6 | NP_493455.1 | leucine-rich repeat | 86..112 | CDD:275381 | 4/25 (16%) |
leucine-rich repeat | 113..138 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 139..163 | CDD:275381 | 10/74 (14%) | ||
leucine-rich repeat | 164..185 | CDD:275381 | 6/20 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160162713 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |