DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and FBXL14

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:NP_689654.1 Gene:FBXL14 / 144699 HGNCID:28624 Length:418 Species:Homo sapiens


Alignment Length:383 Identity:114/383 - (29%)
Similarity:181/383 - (47%) Gaps:38/383 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 LSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSG-------------LLPTLQCRELR--QMP 339
            |:..|.|....::...||||..|||..|.. ..|.|             |.|:||.|.:|  |:.
Human    13 LAMIFGYLDVRDKGRAAQVCTAWRDAAYHK-SVWRGVEAKLHLRRANPSLFPSLQARGIRRVQIL 76

  Fly   340 GCDRGKLYNSLIRRGFHALGLVGASDEDALDVVHSF--PLASKHVHSLSLRCSSISDRGLETLLD 402
            ...|...|.........:|.|.|..:.....:.|:|  .:.|....:||| |..|:|..|..:..
Human    77 SLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSL-CKQITDSSLGRIAQ 140

  Fly   403 HLQSLFELELAGCNEVTEAGL----WACLTPRIVSLSLADCINIADEAVGAVAQLLPS------- 456
            :|:.|..|||.||:.:|..||    |.  ..|:.||:|..|.:::|..:|.:|.:..|       
Human   141 YLKGLEVLELGGCSNITNTGLLLIAWG--LQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLG 203

  Fly   457 LYEFSLQ-AYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVLSLSGCSKL 520
            |.:.:|| ...:||.:|.:.| :....|.:|.|..|..:::.|::::.| :..|..|:|..|..:
Human   204 LEQLTLQDCQKLTDLSLKHIS-RGLTGLRLLNLSFCGGISDAGLLHLSH-MGSLRSLNLRSCDNI 266

  Fly   521 TDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGVG-YISTML 584
            :|.|:..:|....:|..||:|:|.::.|.||.|||..|:.|:.|:|..| ||:|.|:. .:..|.
Human   267 SDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSC-HISDDGINRMVRQMH 330

  Fly   585 SLTALFLRWCSQVRDFGLQHLCS-MRNLQVLSLAGCPLLTSSGLSSLIQLRHLQELEL 641
            .|..|.:..|.::.|.||:.:.. :..|..:.|.||..:|..||..:.||..|:.|.|
Human   331 GLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNL 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 8/23 (35%)
AMN1 383..600 CDD:187754 71/229 (31%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 7/25 (28%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 7/24 (29%)
leucine-rich repeat 535..560 CDD:275381 12/24 (50%)
leucine-rich repeat 561..585 CDD:275381 9/24 (38%)
leucine-rich repeat 586..610 CDD:275381 6/24 (25%)
leucine-rich repeat 636..661 CDD:275381 3/6 (50%)
FBXL14NP_689654.1 Required for down-regulation of SNAI1 2..48 12/35 (34%)
F-box-like 5..46 CDD:403981 11/33 (33%)
AMN1 90..296 CDD:187754 59/210 (28%)
leucine-rich repeat 92..118 CDD:275381 5/25 (20%)
leucine-rich repeat 119..142 CDD:275381 7/23 (30%)
LRR 1 144..163 9/18 (50%)
leucine-rich repeat 145..170 CDD:275381 10/26 (38%)
LRR 2 170..191 7/20 (35%)
leucine-rich repeat 171..203 CDD:275381 8/31 (26%)
LRR 3 203..225 7/22 (32%)
leucine-rich repeat 204..229 CDD:275381 7/25 (28%)
AMN1 228..401 CDD:187754 52/163 (32%)
LRR 4 229..250 5/20 (25%)
leucine-rich repeat 230..254 CDD:275381 6/24 (25%)
LRR 5 254..275 6/20 (30%)
leucine-rich repeat 255..280 CDD:275381 7/24 (29%)
leucine-rich repeat 281..306 CDD:275381 12/24 (50%)
leucine-rich repeat 307..331 CDD:275381 9/24 (38%)
leucine-rich repeat 332..357 CDD:275381 6/24 (25%)
leucine-rich repeat 358..382 CDD:275381 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.