DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32085 and fbxl14

DIOPT Version :9

Sequence 1:NP_729732.1 Gene:CG32085 / 39311 FlyBaseID:FBgn0052085 Length:666 Species:Drosophila melanogaster
Sequence 2:XP_031754473.1 Gene:fbxl14 / 100487109 XenbaseID:XB-GENE-968324 Length:400 Species:Xenopus tropicalis


Alignment Length:391 Identity:112/391 - (28%)
Similarity:181/391 - (46%) Gaps:54/391 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 LSRFFQYFSPYERRILAQVCIKWRDTLYRSPRYWSG-------------LLPTLQCRELRQMPGC 341
            |:..|.|....::...||||..|||..|.. ..|.|             |.|:||.|.:|     
 Frog    13 LAMIFSYLDVRDKGRAAQVCAAWRDAAYHK-SVWRGTEAKLHLRRANPSLFPSLQARGIR----- 71

  Fly   342 DRGKLYNSLIRRGFHALGLVGASDEDALDVV-----------HSFPLASKHVHSLSLR-CSSISD 394
               |:....:||....: :.|..|.::|::.           |:|......:.||:|. |..::|
 Frog    72 ---KVQILSLRRSLSYV-IQGLPDIESLNLSGCYNLTDNGLGHAFVQEIGSLRSLNLSLCKQVTD 132

  Fly   395 RGLETLLDHLQSLFELELAGCNEVTEAGL----WACLTPRIVSLSLADCINIADEAVGAVAQLLP 455
            ..|..:..:|:.|..|||.||..:|..||    |.  ...:.||:|..|.:::|..:|.:|.:..
 Frog   133 SSLGRIAQYLKGLQVLELGGCTNITNTGLLLIAWG--LHGLKSLNLRSCRHVSDVGIGHLAGMTR 195

  Fly   456 S-------LYEFSLQ-AYHVTDAALGYFSPKQSHSLSILRLQSCWELTNHGIVNIVHSLPHLTVL 512
            |       |.:.:|| ...:||.||.:.| :....|.:|.|..|..:::.|::::.| :..|..|
 Frog   196 SAAEGCLGLEQLTLQDCQKLTDLALKHIS-RGLQGLRVLNLSFCGGISDAGLLHLSH-MGGLRSL 258

  Fly   513 SLSGCSKLTDDGVELIAENLQKLRALDLSWCPRITDASLEYIACDLNQLEELTLDRCVHITDIGV 577
            :|..|..::|.|:..:|....:|..||:|:|.::.|.||.|||..|..|:.|:|..| ||:|.|:
 Frog   259 NLRSCDNISDTGIMHLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLYGLKSLSLCSC-HISDDGI 322

  Fly   578 G-YISTMLSLTALFLRWCSQVRDFGLQHLCS-MRNLQVLSLAGCPLLTSSGLSSLIQLRHLQELE 640
            . .:..|..|..|.:..|.::.|.||:.:.. :..|..:.|.||..:|..||..:.||..|:.|.
 Frog   323 NRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKKGLERITQLPCLKVLN 387

  Fly   641 L 641
            |
 Frog   388 L 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32085NP_729732.1 leucine-rich repeat 382..406 CDD:275381 7/24 (29%)
AMN1 383..600 CDD:187754 70/230 (30%)
leucine-rich repeat 431..456 CDD:275381 7/24 (29%)
leucine-rich repeat 457..482 CDD:275381 8/25 (32%)
leucine-rich repeat 483..508 CDD:275381 6/24 (25%)
leucine-rich repeat 509..534 CDD:275381 7/24 (29%)
leucine-rich repeat 535..560 CDD:275381 12/24 (50%)
leucine-rich repeat 561..585 CDD:275381 9/24 (38%)
leucine-rich repeat 586..610 CDD:275381 6/24 (25%)
leucine-rich repeat 636..661 CDD:275381 3/6 (50%)
fbxl14XP_031754473.1 F-box-like 5..46 CDD:403981 11/33 (33%)
AMN1 90..243 CDD:187754 41/155 (26%)
leucine-rich repeat 92..118 CDD:275381 3/25 (12%)
leucine-rich repeat 119..144 CDD:275381 7/24 (29%)
leucine-rich repeat 145..170 CDD:275381 10/26 (38%)
leucine-rich repeat 171..203 CDD:275381 8/31 (26%)
leucine-rich repeat 204..229 CDD:275381 8/25 (32%)
AMN1 228..388 CDD:187754 51/161 (32%)
leucine-rich repeat 230..254 CDD:275381 6/24 (25%)
leucine-rich repeat 255..280 CDD:275381 7/24 (29%)
leucine-rich repeat 281..304 CDD:275381 11/22 (50%)
leucine-rich repeat 307..331 CDD:275381 9/24 (38%)
leucine-rich repeat 332..357 CDD:275381 6/24 (25%)
leucine-rich repeat 358..382 CDD:275381 9/23 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1282076at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.